LitCovid-sentences  

PMC:7258756 / 13347-31687 JSONTXT 12 Projects

Annnotations TAB TSV DIC JSON TextAE Lectin_function

Id Subject Object Predicate Lexical cue
T100 0-7 Sentence denotes Results
T101 8-53 Sentence denotes Detection of SARS-CoV-2 in suspected samples:
T102 54-238 Sentence denotes Three of the 881 TS/nasal swab (NS) specimens from the suspected cases, tested positive for the SARS-CoV-2 using the real-time RT-PCR specific to E gene, RdRp (1), RdRp (2) and N gene.
T103 239-315 Sentence denotes The Ct value of the E gene ranged from 19.8 to 34.5 for the TS/NS specimens.
T104 316-446 Sentence denotes Detailed Ct values for the real-time RT-PCRs specific to the above-mentioned genes of the positive specimens are given in Table I.
T105 447-506 Sentence denotes Blood samples were found to be negative for the SARS-CoV-2.
T106 507-768 Sentence denotes Table I Real-time reverse transcription-polymerase chain reaction (RT-PCR) values for RdRp (1), RdRp (2), E gene and N gene, per cent genome coverage recovered and reads mapped for the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) positive cases
T107 769-935 Sentence denotes Positive cases Ct values for real-time RT-PCR for the confirmation of SARS-CoV-2 Relevant reads Total reads Genome length recovered (bp) Per cent genome coverage
T108 936-996 Sentence denotes RdRp (1) RdRp (2) E gene N gene Rnase P internal control
T109 997-1074 Sentence denotes Case 1 33.33 27.93 34.5 33.90 Positive 20,096 5,615,846 29,854 99.83
T110 1075-1142 Sentence denotes Case 2 24.6 29 19.8 38 Positive 610 8,587,146 16,047 53.66
T111 1143-1363 Sentence denotes Case 3 34.17 32.64 28.98 36.35 Positive 11,296 1,405,038 29,851 99.83 Case 1 travelled from Wuhan, China, reached India on January 23, 2020 and further travelled to the final destination of Kerala on January 24.
T112 1364-1522 Sentence denotes This individual developed cough on January 25 and further experienced a sore throat and mild fever and was admitted to the General Hospital, Thrissur, Kerala.
T113 1523-1646 Sentence denotes The second case travelled from Wuhan and had close contact with case 1 during the travel to the final destination in India.
T114 1647-1802 Sentence denotes Case 2 developed similar symptoms along with fever and diarrhoea on January 26, and the collected TS specimens were referred to the ICMR-NIV on January 28.
T115 1803-1891 Sentence denotes The second case was hospitalized on January 30, in a medical college, Alappuzha, Kerala.
T116 1892-1951 Sentence denotes The clinical sample (TS) was collected on January 31, 2020.
T117 1952-2108 Sentence denotes Case 3 travelled from China to India, developed a runny nose on January 30 and was admitted to the General Hospital, Kasaragod, Kerala, on January 31, 2020.
T118 2109-2157 Sentence denotes TS specimens were collected on January 31, 2020.
T119 2158-2341 Sentence denotes NGS of SARS-CoV-2 from India - Phylogenetic analysis and molecular characterization: NGS analysis from the TS specimens retrieved two complete genome sequences from case 1 and case 3.
T120 2342-2511 Sentence denotes The complete genomic sequence data for case 2 could not be recovered due to the lower kappa concentration of the sample and hence not included in the study for analysis.
T121 2512-2671 Sentence denotes The FastQ files were reference mapped with the available Wuhan seafood pneumonia virus (Wuhan Hu-1) complete SARS-CoV-2 genome (accession number: NC 045512.2).
T122 2672-2793 Sentence denotes The total reads which were mapped and the percentage of the genome recovered for the two cases are summarized in Table I.
T123 2794-3003 Sentence denotes Analysis of the complete genome sequences of SARS-CoV-2 from the positive cases in India revealed that the percentage nt and aa differences between case 1 and case 3 were 0.038 and 0.10 per cent, respectively.
T124 3004-3132 Sentence denotes The sequences of case 1 and case 3 diverged from the Wuhan-Hu1 sequence by 0.017 per cent nt and 0.041 per cent aa respectively.
T125 3133-3280 Sentence denotes Indian SARS-CoV-2 clustered with the Sarbecovirus subgenus of the Betacoronavirus genus and was closest to the BatCoV RaTG13 sequence (96.09% nt)8.
T126 3281-3441 Sentence denotes The phylogenetic comparison showed the clustering of the genome sequences of case 1 and case 3 with the existing sequences of the SARS-CoV-2 sequences (Fig. 1).
T127 3442-3529 Sentence denotes The phylogeny revealed emerging heterogeneity within the SARS-CoV-2 sequences globally.
T128 3530-3598 Sentence denotes The Indian SARS-CoV-2 viruses were positioned in different clusters.
T129 3599-3708 Sentence denotes Fig. 1 Phylogenetic tree of the complete genomes of severe acute respiratory syndrome coronavirus 2 viruses.
T130 3709-3757 Sentence denotes Indian viruses are shown in magenta font colour.
T131 3758-3890 Sentence denotes Indian SARS-CoV-2 sequences showed two changes 408 Arg→Ile and 930 Ala→Val in the spike protein compared to the Wuhan Hu-1 sequence.
T132 3891-4109 Sentence denotes The mutations were further mapped on the spike protein model of the Indian sequence (Supplementary Fig. 1 (available from http://www.ijmr.org.in/articles/2020/151/2/images/IndianJMedRes_2020_151_2_200_281471_sm6.pdf)).
T133 4110-4314 Sentence denotes Deletion of a three-nucleotide stretch, encoding tyrosine residue at position 144, of the spike gene was also observed in the Indian SARS-CoV-2 from case 1 when compared to the other SARS-CoV-2 sequences.
T134 4315-4523 Sentence denotes As noted in the earlier SARS-CoV-2 sequences, both the Indian sequences possessed the polybasic cleavage site (RRAR) in the spike protein at the junction of S1 and S2, the two subunits of the spike protein19.
T135 4524-4544 Sentence denotes Epitope predictions:
T136 4545-4718 Sentence denotes Thirty one linear B-cell epitopes were predicted by Bepipred in the Indian SARS-CoV-2, of which three were found to have a length of <6 amino acids and hence not considered.
T137 4719-4848 Sentence denotes Linear epitopes were also predicted using the ABCpred prediction tool, which predicted 47 epitopes based on the threshold of 0.8.
T138 4849-4927 Sentence denotes Regions common to both the prediction methods (n=17) were identified manually.
T139 4928-5113 Sentence denotes The 17 epitopes were screened for their antigenicity using the VaxiJen v2.0 tool (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html), and nine of these epitopes were shortlisted.
T140 5114-5244 Sentence denotes These epitopes were further screened for their ability to elicit an IFN-γ response, which was predicted using the IFNepitope tool.
T141 5245-5425 Sentence denotes Finally, five epitopes, four in the S1 domain and one in the S2 domain, were predicted, which could possibly generate an immune response and suppress the IFN-γ response (Table II).
T142 5426-5598 Sentence denotes N-linked glycosylation site prediction revealed that two putative glycosylation sites (with a low value for jury agreement) were present within the epitope stretch 328-344.
T143 5599-5724 Sentence denotes Table II Linear B-cell epitopes predicted on the spike protein of the Indian severe acute respiratory syndrome coronavirus 2
T144 5725-5798 Sentence denotes Peptide Epitope probability Vaxigen score Interferon (IFN)-γ response#
T145 5799-5860 Sentence denotes 243-HRSYLTPGDSSSGWTA-258 0.92 Antigen (0.602) Negative (1)
T146 5861-5927 Sentence denotes 327-FPNITNLCPFGEVFNA-342 0.82 Antigen (0.606) Negative (−0.132)
T147 5928-5989 Sentence denotes 404-EVIQIAPGQTGKIADY-419 0.86 Antigen (1.231) Negative (1)
T148 5990-6057 Sentence denotes 413-TGKIADYNYKLPDDFT-428 0.84 Antigen (0.9642) Negative (−0.334)
T149 6058-6121 Sentence denotes 1204-YEQYIKWPWYIWLGFI-1219 0.89 Antigen (0.951) Negative (1)
T150 6122-6223 Sentence denotes Epitopes were predicted using a combination of the Bepipred server and the ABCpred prediction server.
T151 6224-6283 Sentence denotes The antigenicity was predicted using the VaxiJen v2.0 tool.
T152 6284-6548 Sentence denotes IFN-γ response was predicted using the INFepitope server. #Values in bracket show prediction score given by the software The discontinuous epitopes in the spike protein of the Indian SARS-CoV-2 were further identified using multiple methods, Ellipro and DiscoTope.
T153 6549-6684 Sentence denotes Conformational epitopes based on these methods were mapped on the pre-fusion structure of the modelled Indian SARS-CoV-2 spike protein.
T154 6685-6810 Sentence denotes The newly released structure of the SARS-CoV-2 spike protein was used as the template for modelling the Indian spike protein.
T155 6811-6996 Sentence denotes Ramachandran plot statistics revealed 83.7 per cent of the residues to be in the core region, 14.4 per cent in the additionally allowed region and 0.5 per cent in the disallowed region.
T156 6997-7208 Sentence denotes Four epitopes were predicted by Ellipro based on the PI threshold of 0.8 (Supplementary Table II (available from http:/ /www. ijmr.org.in/articles/2020/151/2/images/IndianJMedRes_2020_151_2_200_281471_sm7.pdf)).
T157 7209-7393 Sentence denotes The result from the DiscoTope is presented in Supplementary Table III (available from http://www.ijmr.org.in/articles/ 2020/151/2/ images/ IndianJMedRes_2020_151_2_200_281471_sm8.pdf).
T158 7394-7454 Sentence denotes The mapped conformational epitopes are depicted in Figure 2.
T159 7455-7946 Sentence denotes For the purpose of comparison, the Indian S protein sequence was also modelled using the pre-fusion structure of SARS-CoV-1 (6ACC.PDB; 87.29% identity), and the results for the conformational epitopes predicted are in Supplementary Table IV (available from http://www.ijmr.org.in/articles/2020/151/2/images/IndianJMedRes_2020_151_2_200_28147 1_sm9.pdf and Supplementary Figure 2 (available from http://www.ijmr.org.in/articles/2020/151/2/images/IndianJMedRes_2020_151_2_200_281471_sm10.pdf).
T160 7947-8164 Sentence denotes Supplementary Table II Conformational B-cell epitopes predicted by Ellipro based on the chains A, B and C of the Indian severe acute respiratory syndrome coronavirus 2 spike protein modelled structure (template used:
T161 8165-8175 Sentence denotes 6VSB.PDB).
T162 8176-8228 Sentence denotes Ellipro protusion Index threshold set to 0.8 cut-off
T163 8229-8251 Sentence denotes Chain A Ellipro Score
T164 8252-8316 Sentence denotes 1 D1137, P1138, L1139, Q1140, P1141, E1142, L1143, D1144 0.984
T165 8317-8664 Sentence denotes 2 Y705, S706, N707, N708, S709, T1074, T1075, A1076, P1077, A1078, I1079, C1080, H1081, D1082, G1083, K1084, A1085, H1086, F1087, P1088, R1089, E1090, G1091, F1093, V1094, S1095, N1096, G1097, T1098, H1099, W1100, F1101, V1102, Y1108, E1109, P1110, Q1111, I1112, I1113, T1114, T1115, D1116, N1117, T1118, F1119, V1120, S1121, G1122, N1123, 0.906
T166 8665-9273 Sentence denotes 3 N341, A342, T343, R344, F345, A346, S347, V348, Y349, A350, W351, N352, S397, F398, V399, I400, R401, E404, Q412, T413, G414, K415, I416, A417, D418, Y419, N420, Y421, K422, L423, S436, N437, N438, L439, D440, S441, K442, V443, G444, G445, N446, Y447, N448, Y449, L450, Y451, R452, L453, F454, R455, K456, S457, N458, L459, K460, P461, F462, E463, R464, D465, I466, S467, T468, E469, I470, Y471, Q472, A473, G474, S475, T476, P477, C478, N479, G480, V481, G483, F484, N485, C486, Y487, F488, P489, L490, Q491, S492, Y493, G494, F495, Q496, P497, T498, N499, G500, V501, G502, Y503, Q504, P505, R507 0.887
T167 9274-9588 Sentence denotes 4 I68, H69, V70, S71, G72, T73, N74, G75, T76, K77, R78, S98, I100, C136, D138, F140, G142, Y143, H144, K145, N146, N147, K148, S149, W150, M151, E152, S153, E154, F155, R156, N183, F184, A241, L242, H243, R244, S245, Y246, L247, T248, P249, G250, D251, S252, S253, S254, G255, W256, T257, A258, G259, A260 0.876
T168 9589-9596 Sentence denotes Chain B
T169 9597-10133 Sentence denotes 1 A704, Y705, S706, N707, N708, S709, F1073, T1074, T1075, A1076, P1077, A1078, I1079, C1080, H1081, D1082, G1083, K1084, A1085, H1086, F1087, P1088, R1089,E1090, G1091, V1092,F1093, V1094, S1095, N1096, G1097, T1098, H1099, W1100, F1101, V1102, T1103, Q1104, R1105, F1107, Y1108, E1109,P1110, Q1111, I1112, I1113, T1114, T1115, D1116, N1117, T1118, F1119, V1120, S1121, G1122, N1123, C1124, D1125, V1126, V1127, I1128, G1129, I1130, V1131, N1132, N1133, T1134, V1135, Y1136, D1137, P1138, L1139, Q1140,P1141,E1142, L1143, D1144 0.902
T170 10134-10682 Sentence denotes 2 N341, A342, T343, F345, A346, S347, V348, Y349, A350, W351, V399, R401, G402, T413, G414, K415, D418, Y419, N420, Y421, K422, S436, N437, N438, L439, D440, S441, K442, V443, G444, G445, N446, Y447, N448, Y449, L450, Y451, R452, L453, F454, R455, K456, S457, N458, L459, K460, P461, E463, R464, D465, I466, S467, T468, E469, I470, Y471, Q472, A473, G474, S475, T476, P477, C478, N479, G480, V481, E482, G483, F484, N485, C486, Y487, F488, P489, L490, Q491, S492, Y493, G494, F495, Q496, P497, T498, N499, G500, V501, G502, Y503, Q504, P505 0.886
T171 10683-11065 Sentence denotes 3 A67, I68, H69, V70, S71, G72, T73, N74, G75, T76, K77, R78, E96, K97, S98, N99, I100, R102, N122, A123, T124, N125, C136, N137, D138, P139, F140, L141, G142, Y143, H144, K145, N146, N147, K148, S149, W150, M151, E152, S153, E154, F155, L239, L240, A241, L242, H243, R244, S245, Y246, L247, T248, P249, G250, D251, S252, S253, S254, G255, W256, T257, A258, G259, A260, A261 0.869
T172 11066-11073 Sentence denotes Chain C
T173 11074-11138 Sentence denotes 1 D1137, P1138, L1139, Q1140, P1141, E1142, L1143, D1144 0.984
T174 11139-11576 Sentence denotes 2 Y705, S706, N707, N708, S709, T1074, T1075, A1076, P1077, A1078, I1079, C1080, H1081, D1082, G1083, K1084, A1085, H1086, F1087, P1088, R1089, E1090, G1091, F1093, V1094, S1095, N1096, G1097, T1098, H1099, W1100, F1101, V1102, Y1108, E1109, P1110, Q1111, I1112, I1113, T1114, T1115, D1116, N1117, T1118, F1119, V1120, S1121, G1122, N1123, C1124, D1125, V1126, V1127, I1128, G1129, I1130, V1131, N1132, N1133, T1134, V1135, Y1136 0.906
T175 11577-12185 Sentence denotes 3 N341, A342, T343, R344, F345, A346, S347, V348, Y349, A350, W351, N352, S397, F398, V399, I400, R401, E404, Q412, T413, G414, K415, I416, A417, D418, Y419, N420, Y421, K422, L423, S436, N437, N438, L439, D440, S441, K442, V443, G444, G445, N446, Y447, N448, Y449, L450, Y451, R452, L453, F454, R455, K456, S457, N458, L459, K460, P461, F462, E463, R464, D465, I466, S467, T468, E469, I470, Y471, Q472, A473, G474, S475, T476, P477, C478, N479, G480, V481, G483, F484, N485, C486, Y487, F488, P489, L490, Q491, S492, Y493, G494, F495, Q496, P497, T498, N499, G500, V501, G502, Y503, Q504, P505, R507 0.887
T176 12186-12500 Sentence denotes 4 I68, H69, V70, S71, G72, T73, N74, G75, T76, K77, R78, S98, I100, C136, D138, F140, G142, Y143, H144, K145, N146, N147, K148, S149, W150, M151, E152, S153, E154, F155, R156, N183, F184, A241, L242, H243, R244, S245, Y246, L247, T248, P249, G250, D251, S252, S253, S254, G255, W256, T257, A258, G259, A260 0.876
T177 12501-12921 Sentence denotes Fig. 2 Predicted conformational B-cell epitopes mapped on the pre-fusion structure of the modelled Indian severe acute respiratory syndrome coronavirus 2 spike protein using the pre-fusion structure of severe acute respiratory syndrome-coronavirus-2 (6VSB.PDB) (colour key: blue - epitopes 67-261; green - epitopes 341-507 based on the predicted epitopes as shown in Supplementary Table II). (A) Top view (B) Side view.
T178 12922-13157 Sentence denotes Supplementary Table III Conformational B-cell epitopes predicted by the Discotope server based on the chain A, B and C of India severe acute respiratory syndrome coronavirus 2 spike protein modelled structure (template used 6VSB.PDB).
T179 13158-13197 Sentence denotes Discotope threshold set to -3.7 cut-off
T180 13198-13781 Sentence denotes CHAIN A 71S, 72G, 73T, 74N, 75G, 76T, 148K, 149S, 150W, 151M, 152E, 178E, 179G, 180K, 181Q, 209N, 245S, 247L, 248T, 250G, 252S, 253S, 440D, 441S, 442K, 443V, 444G, 445G, 446N, 447Y, 448N, 452R, 453L, 454F, 455R, 456K, 458N, 460K, 461P, 465D, 468T, 470I, 482E, 487Y, 488F, 489P, 490L, 491Q, 492S, 493Y, 494G, 495F, 496Q, 497P, 498T, 499N, 500G, 501V, 502G, 554N, 556K, 558L, 559P, 560F, 568A, 677N, 678S, 679P, 680R, 681R, 682A, 683R, 701N, 702S, 703V, 791P, 792I, 807P, 808S, 810P, 912N, 915Y, 916E, 1069Q, 1097G, 1099H, 1116D, 1137D, 1138P, 1139L, 1140Q, 1141P, 1142E, 1143L, 1144D
T181 13782-14342 Sentence denotes CHAIN B 70V, 73T, 74N, 75G, 76T, 147N, 148K, 149S, 150W, 151M, 176D, 177L, 178E, 179G, 180K, 181Q, 182G, 183N, 212R, 244R, 245S, 246Y, 247L, 248T, 249P, 250G, 251D, 252S, 253S, 254S, 255G, 256W, 438N, 441S, 442K, 443V, 444G, 445G, 446N, 447Y, 454F, 456K, 457S, 458N, 460K, 467S, 476T, 492S, 494G, 495F, 496Q, 497P, 498T, 499N, 500G, 501V, 502G, 503Y, 554N, 556K, 558L, 559P, 676T, 677N, 678S, 679P, 680R, 701N, 702S, 703V, 714T, 791P, 792I, 807P, 808S, 810P, 912N, 915Y, 916E, 1069Q, 1109E, 1112I, 1116D, 1137D, 1138P, 1139L, 1140Q, 1141P, 1142E, 1143L, 1144D
T182 14343-14854 Sentence denotes CHAIN C 72G, 73T, 74N, 75G, 97K, 98S, 143Y, 144H, 145K, 146N, 147N, 148K, 149S, 150W, 151M, 152E, 153S, 180K, 181Q, 182G, 183N, 184F, 209N, 252S, 253S, 441S, 442K, 443V, 444G, 445G, 446N, 447Y, 454F, 456K, 457S, 458N, 460K, 480G, 492S, 494G, 496Q, 497P, 498T, 499N, 500G, 501V, 502G, 503Y, 554N, 556K, 558L, 559P, 676T, 678S, 679P, 680R, 681R, 682A, 683R, 684S, 685V, 701N, 702S, 714T, 791P, 792I, 807P, 808S, 912N, 915Y, 916E, 1069Q, 1072N, 1098T, 1112I, 1116D, 1138P, 1139L, 1140Q, 1141P, 1142E, 1143L, 1144D
T183 14855-14985 Sentence denotes Supplementary Table IV Conformational B-cell epitopes predicted using the modelled structure of the spike protein (template used:
T184 14986-15096 Sentence denotes 6ACC.PDB; 87.29% identity). (A) Ellipro server (using a protusion Index threshold of 0.9) (B) DiscoTope server
T185 15097-15099 Sentence denotes A.
T186 15100-15126 Sentence denotes Ellipro epitope prediction
T187 15127-15174 Sentence denotes Epitope number Epitope residues Epitope score
T188 15175-15205 Sentence denotes 1 244-RSYLTPGDSSSGW-256 0.95
T189 15206-15309 Sentence denotes 2 347S, 349Y, 419Y, 441-SKVGGNYNYLYRLFR-455, 457S, 465-DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN -499 0.943
T190 15310-15406 Sentence denotes 3 1074 TTAPAICHDGKAHFPR 1089, 1094-VSNGTHWFV-1102, 1110- PQIITTDNTFVSGNCDVVIGIVNNTV-1135 0.934
T191 15407-15436 Sentence denotes 4 144-HKNNKSWMESE-154 0.912
T192 15437-15459 Sentence denotes 5 72-GTNGTK-77 0.907
T193 15460-15462 Sentence denotes B.
T194 15463-15491 Sentence denotes DiscoTope epitope prediction
T195 15492-16120 Sentence denotes G72, T73, N74, G75, K145, N146, N147, K148, S149, L174, E178, K180, Q181, G182, 183, V211, S245, Y246, L247, T248, P249, G250, D251, S252, S253, K415, N438, S441, K442, V443, G444, G445, N446, Y447, N448, K456, S457, N458, K460, A473, G474, S475, S492, G494, Q496, P497, T498, N499, G500, V501, Y503, N554, K556, L558, P559, I567, Q675, T676, N677, S678, P679, R680, R681, A682, R683, S702, V703, A704, Y705, T714, P791, P807, S808, K809, P810, E916, Q1069, E1070 T-cell epitope prediction revealed 105 strong binding epitopes capable of binding to different HLA types using the NetCTL1.2 software based on the threshold of 0.4.
T196 16121-16251 Sentence denotes Twelve of these were shortlisted, considering a binding efficiency of >0.5 nM and capable of eliciting IFN-γ response (Table III).
T197 16252-16384 Sentence denotes Table III Spike protein peptides capable of binding to major histocompatibility complex (MHC) class I predicted using NetCTL server
T198 16385-16472 Sentence denotes Peptide Vaxijen Interferon (IFN)-γ response CTLPred Score (ANN/SVM) MHC restriction
T199 16473-16576 Sentence denotes 89-GVYFASTEK-97 0.711 Positive (1) 0.58/0.986 HLA-A*1101, HLA-A3, HLA-A*3101, HLA-A68.1, HLA-B*2705
T200 16577-16810 Sentence denotes 166-FEYVSQPFL-174 0.632 Positive (0.087) 0.65/0.184 HLA-A2, HLA-A*0201, HLA-A*0205, HLA-A2.1, HLA-B*2702, HLA-B*2705, HLA-B*3701, HLA-B40, HLA-B*4403, HLA-B*5301, HLA-B*5401, HLA-B*51, HLA-B60, HLA-B61, HLA-Cw*0301, H2-Kb, H2-Kk,
T201 16811-16977 Sentence denotes 256-WTAGAAAYY-264 0.630 Positive (0.576) 0.82/0.544 HLA-A1, HLA-B*2702, HLA-B*3501, HLA-B*4403, HLA-B*5301, HLA-B*5401, HLA-B*51, HLA-B*5801, HLA-B62, HLA-Cw*0702
T202 16978-17121 Sentence denotes 348-VYAWNRKRI-356 0.500 Positive (0.499) 0.93/0.497 HLA-A24, HLA-B*5101, HLA-B*5102, HLA-B*5103, HLA-B*51, HLA-Cw*0401, H2-Db, H2-Kd, H2-Kk
T203 17122-17381 Sentence denotes 503-YQPYRVVVL-511 0.596 Positive (0.292) 0.40/0.596 HLA-A*0201, HLA-A*0205, HLA-A24, HLA-B14, HLA-B*2702, HLA-B*2705, HLA-B*3902, HLA-B*5201, HLA-B*5301, HLA-B*5401, HLA-B*51, HLA-B60, HLA-B62, HLA-B7, HLA-B8, HLA-Cw*0401, HLA-Cw*0602, H2-Dd, H2-Kb, H2-Ld
T204 17382-17499 Sentence denotes 510-VLSFELLHA-518 1.077 Positive (0.268) 0.86/0.276 HLA-A*0201, HLA-A*0205, HLA-A3, HLA-B*5301, HLA-B*51, HLA-B62
T205 17500-17626 Sentence denotes 825-TLADAGFIK-833 0.578 Positive (0.014) 0.75/0.992 HLA-A1, HLA-A*1101, HLA-A3, HLA-A*3101, HLA-A68.1, HLA-A20, HLA-B*2705
T206 17627-17823 Sentence denotes 1058-VVFLHVTYV-1066 1.512 Positive (1) 0.77/0.779 HLA-A2, HLA-A*0201, HLA-A*0205, HLA-A68.1, HLA-A2.1, HLA-B14, HLA-B*5101, HLA-B*5102, HLA-B*5103, HLA-B*5201, HLA-B*5301, HLA-B*5401, HLA-B*51
T207 17824-18064 Sentence denotes 1210-WPWYIWLGF-1218 1.495 Positive (0.221) 0.68/0.0695 HLA-B*2702, HLA-B*2705, HLA-B*3501, HLA-B*3801, HLA-B*5101, HLA-B*5102, HLA-B*5201, HLA-B*5301, HLA-B*5401, HLA-B*51, HLA-B*5801, HLA-B62, HLA-B*0702, HLA-Cw*0401, HLA-Cw*0702.H2-Ld
T208 18065-18139 Sentence denotes Threshold of >0.7 nM was used for increased specificity of the prediction.
T209 18140-18216 Sentence denotes The peptides were reconfirmed using CTLPred server using default parameters.
T210 18217-18340 Sentence denotes The peptides that were classified as epitopes were further checked for their antigenicity score using the VaxiJen v2.0 tool