> top > projects > sentences > docs > PubMed:32518941 > annotations
sentences Home  

PubMed:32518941 JSONTXT 22 Projects

Annnotations TAB TSV DIC JSON TextAE

Id Subject Object Predicate Lexical cue
T1 0-169 Sentence denotes Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: implications for vaccination and antibody therapeutics.
T1 0-169 Sentence denotes Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: implications for vaccination and antibody therapeutics.
T2 170-261 Sentence denotes Coronaviruses hijack human enzymes to assemble the sugar coat on their spike glycoproteins.
T2 170-261 Sentence denotes Coronaviruses hijack human enzymes to assemble the sugar coat on their spike glycoproteins.
T3 262-391 Sentence denotes The mechanisms by which human antibodies may recognize the antigenic viral peptide epitopes hidden by the sugar coat are unknown.
T3 262-391 Sentence denotes The mechanisms by which human antibodies may recognize the antigenic viral peptide epitopes hidden by the sugar coat are unknown.
T4 392-577 Sentence denotes Glycosylation by insect cells differs from the native form produced in human cells, but insect cell-derived influenza vaccines have been approved by the US Food and Drug Administration.
T4 392-577 Sentence denotes Glycosylation by insect cells differs from the native form produced in human cells, but insect cell-derived influenza vaccines have been approved by the US Food and Drug Administration.
T5 578-810 Sentence denotes In this study, we analyzed recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein secreted from BTI-Tn-5B1-4 insect cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis.
T5 578-810 Sentence denotes In this study, we analyzed recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein secreted from BTI-Tn-5B1-4 insect cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis.
T6 811-925 Sentence denotes We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites.
T6 811-925 Sentence denotes We acquired tandem mass spectrometry (MS/MS) spectrums for glycopeptides of all 22 predicted N-glycosylated sites.
T7 926-1114 Sentence denotes We further analyzed the surface accessibility of spike proteins according to cryogenic electron microscopy and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1.
T7 926-1114 Sentence denotes We further analyzed the surface accessibility of spike proteins according to cryogenic electron microscopy and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1.
T8 1115-1196 Sentence denotes All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans.
T8 1115-1196 Sentence denotes All 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose N-glycans.
T9 1197-1265 Sentence denotes MS/MS fragmentation clearly established the glycopeptide identities.
T9 1197-1265 Sentence denotes MS/MS fragmentation clearly established the glycopeptide identities.
T10 1266-1470 Sentence denotes Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1.
T10 1266-1470 Sentence denotes Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1.
T11 1471-1598 Sentence denotes Other surface-exposed domains include those located on central helix, connecting region, heptad repeats, and N-terminal domain.
T11 1471-1598 Sentence denotes Other surface-exposed domains include those located on central helix, connecting region, heptad repeats, and N-terminal domain.
T12 1599-1917 Sentence denotes Because the majority of antibody paratopes bind to the peptide portion with or without sugar modification, we propose a snake-catching model for predicted paratopes: a minimal length of peptide is first clamped by a paratope, and sugar modifications close to the peptide either strengthen or do not hinder the binding.
T12 1599-1917 Sentence denotes Because the majority of antibody paratopes bind to the peptide portion with or without sugar modification, we propose a snake-catching model for predicted paratopes: a minimal length of peptide is first clamped by a paratope, and sugar modifications close to the peptide either strengthen or do not hinder the binding.