Id |
Subject |
Object |
Predicate |
Lexical cue |
T593 |
11-13 |
PRP |
denotes |
We |
T595 |
14-18 |
VBP |
denotes |
have |
T596 |
19-27 |
RB |
denotes |
recently |
T594 |
28-34 |
VBN |
denotes |
cloned |
T597 |
35-38 |
CC |
denotes |
and |
T598 |
39-52 |
VBN |
denotes |
characterized |
T599 |
53-54 |
DT |
denotes |
a |
T601 |
55-60 |
JJ |
denotes |
novel |
T602 |
61-65 |
NN |
denotes |
gene |
T600 |
66-72 |
NN |
denotes |
family |
T603 |
73-78 |
VBN |
denotes |
named |
T604 |
79-86 |
JJ |
denotes |
ancient |
T606 |
87-96 |
VBN |
denotes |
conserved |
T607 |
97-103 |
NN |
denotes |
domain |
T605 |
104-111 |
NN |
denotes |
protein |
T608 |
112-113 |
-LRB- |
denotes |
( |
T609 |
113-117 |
NN |
denotes |
ACDP |
T610 |
117-118 |
-RRB- |
denotes |
) |
T611 |
119-124 |
WDT |
denotes |
which |
T612 |
125-132 |
VBZ |
denotes |
encodes |
T613 |
133-137 |
CD |
denotes |
four |
T615 |
138-145 |
NN |
denotes |
protein |
T614 |
146-153 |
NNS |
denotes |
members |
T616 |
154-156 |
IN |
denotes |
in |
T617 |
157-163 |
NNS |
denotes |
humans |
T618 |
164-165 |
-LRB- |
denotes |
[ |
T619 |
165-166 |
CD |
denotes |
1 |
T620 |
166-167 |
-RRB- |
denotes |
] |
T621 |
167-168 |
. |
denotes |
. |
T622 |
168-320 |
sentence |
denotes |
We found that this gene family is evolutionarily conserved in diverse species ranging from bacteria, yeast, C. elegans, and D. melanogaster to mammals. |
T623 |
169-171 |
PRP |
denotes |
We |
T624 |
172-177 |
VBD |
denotes |
found |
T625 |
178-182 |
IN |
denotes |
that |
T627 |
183-187 |
DT |
denotes |
this |
T629 |
188-192 |
NN |
denotes |
gene |
T628 |
193-199 |
NN |
denotes |
family |
T626 |
200-202 |
VBZ |
denotes |
is |
T630 |
203-217 |
RB |
denotes |
evolutionarily |
T631 |
218-227 |
JJ |
denotes |
conserved |
T632 |
228-230 |
IN |
denotes |
in |
T633 |
231-238 |
JJ |
denotes |
diverse |
T634 |
239-246 |
NNS |
denotes |
species |
T635 |
247-254 |
VBG |
denotes |
ranging |
T636 |
255-259 |
IN |
denotes |
from |
T637 |
260-268 |
NNS |
denotes |
bacteria |
T638 |
268-270 |
, |
denotes |
, |
T639 |
270-275 |
NN |
denotes |
yeast |
T640 |
275-277 |
, |
denotes |
, |
T641 |
277-279 |
NNP |
denotes |
C. |
T642 |
280-287 |
NNP |
denotes |
elegans |
T643 |
287-289 |
, |
denotes |
, |
T644 |
289-292 |
CC |
denotes |
and |
T645 |
293-295 |
NNP |
denotes |
D. |
T646 |
296-308 |
NNP |
denotes |
melanogaster |
T647 |
309-311 |
IN |
denotes |
to |
T648 |
312-319 |
NNS |
denotes |
mammals |
T649 |
319-320 |
. |
denotes |
. |
T650 |
320-459 |
sentence |
denotes |
The sequence conservation and the presence of multiple members within a species may imply functional importance associated with the genes. |
T651 |
321-324 |
DT |
denotes |
The |
T653 |
325-333 |
NN |
denotes |
sequence |
T652 |
334-346 |
NN |
denotes |
conservation |
T655 |
347-350 |
CC |
denotes |
and |
T656 |
351-354 |
DT |
denotes |
the |
T657 |
355-363 |
NN |
denotes |
presence |
T658 |
364-366 |
IN |
denotes |
of |
T659 |
367-375 |
JJ |
denotes |
multiple |
T660 |
376-383 |
NNS |
denotes |
members |
T661 |
384-390 |
IN |
denotes |
within |
T662 |
391-392 |
DT |
denotes |
a |
T663 |
393-400 |
NN |
denotes |
species |
T664 |
401-404 |
MD |
denotes |
may |
T654 |
405-410 |
VB |
denotes |
imply |
T665 |
411-421 |
JJ |
denotes |
functional |
T666 |
422-432 |
NN |
denotes |
importance |
T667 |
433-443 |
VBN |
denotes |
associated |
T668 |
444-448 |
IN |
denotes |
with |
T669 |
449-452 |
DT |
denotes |
the |
T670 |
453-458 |
NNS |
denotes |
genes |
T671 |
458-459 |
. |
denotes |
. |
T672 |
459-607 |
sentence |
denotes |
To facilitate the functional analysis of the ACDP gene family, we cloned and characterized Acdp, the mouse homologue of the human ACDP gene family. |
T673 |
460-462 |
TO |
denotes |
To |
T674 |
463-473 |
VB |
denotes |
facilitate |
T676 |
474-477 |
DT |
denotes |
the |
T678 |
478-488 |
JJ |
denotes |
functional |
T677 |
489-497 |
NN |
denotes |
analysis |
T679 |
498-500 |
IN |
denotes |
of |
T680 |
501-504 |
DT |
denotes |
the |
T682 |
505-509 |
NN |
denotes |
ACDP |
T683 |
510-514 |
NN |
denotes |
gene |
T681 |
515-521 |
NN |
denotes |
family |
T684 |
521-523 |
, |
denotes |
, |
T685 |
523-525 |
PRP |
denotes |
we |
T675 |
526-532 |
VBD |
denotes |
cloned |
T686 |
533-536 |
CC |
denotes |
and |
T687 |
537-550 |
VBD |
denotes |
characterized |
T688 |
551-555 |
NN |
denotes |
Acdp |
T689 |
555-557 |
, |
denotes |
, |
T690 |
557-560 |
DT |
denotes |
the |
T692 |
561-566 |
NN |
denotes |
mouse |
T691 |
567-576 |
NN |
denotes |
homologue |
T693 |
577-579 |
IN |
denotes |
of |
T694 |
580-583 |
DT |
denotes |
the |
T696 |
584-589 |
JJ |
denotes |
human |
T697 |
590-594 |
NN |
denotes |
ACDP |
T698 |
595-599 |
NN |
denotes |
gene |
T695 |
600-606 |
NN |
denotes |
family |
T699 |
606-607 |
. |
denotes |
. |
T863 |
618-627 |
JJ |
denotes |
Molecular |
T864 |
628-635 |
NN |
denotes |
cloning |
T865 |
636-638 |
IN |
denotes |
of |
T866 |
639-642 |
DT |
denotes |
the |
T868 |
643-647 |
NN |
denotes |
Acdp |
T869 |
648-652 |
NN |
denotes |
gene |
T867 |
653-659 |
NN |
denotes |
family |
T870 |
659-823 |
sentence |
denotes |
To clone the mouse Acdp genes, the human ACDP cDNA and predicted protein sequences were used to search the mouse EST database with the blastn and tblastn programs. |
T871 |
660-662 |
TO |
denotes |
To |
T872 |
663-668 |
VB |
denotes |
clone |
T874 |
669-672 |
DT |
denotes |
the |
T876 |
673-678 |
NN |
denotes |
mouse |
T877 |
679-683 |
NN |
denotes |
Acdp |
T875 |
684-689 |
NNS |
denotes |
genes |
T878 |
689-691 |
, |
denotes |
, |
T879 |
691-694 |
DT |
denotes |
the |
T881 |
695-700 |
JJ |
denotes |
human |
T882 |
701-705 |
NN |
denotes |
ACDP |
T880 |
706-710 |
NN |
denotes |
cDNA |
T883 |
711-714 |
CC |
denotes |
and |
T884 |
715-724 |
JJ |
denotes |
predicted |
T886 |
725-732 |
NN |
denotes |
protein |
T885 |
733-742 |
NNS |
denotes |
sequences |
T887 |
743-747 |
VBD |
denotes |
were |
T873 |
748-752 |
VBN |
denotes |
used |
T888 |
753-755 |
TO |
denotes |
to |
T889 |
756-762 |
VB |
denotes |
search |
T890 |
763-766 |
DT |
denotes |
the |
T892 |
767-772 |
NN |
denotes |
mouse |
T893 |
773-776 |
NN |
denotes |
EST |
T891 |
777-785 |
NN |
denotes |
database |
T894 |
786-790 |
IN |
denotes |
with |
T895 |
791-794 |
DT |
denotes |
the |
T897 |
795-801 |
NN |
denotes |
blastn |
T898 |
802-805 |
CC |
denotes |
and |
T899 |
806-813 |
NN |
denotes |
tblastn |
T896 |
814-822 |
NNS |
denotes |
programs |
T900 |
822-823 |
. |
denotes |
. |
T901 |
823-897 |
sentence |
denotes |
Mouse EST markers corresponding to each Acdp member were then identified. |
T902 |
824-829 |
NN |
denotes |
Mouse |
T904 |
830-833 |
NN |
denotes |
EST |
T903 |
834-841 |
NNS |
denotes |
markers |
T906 |
842-855 |
VBG |
denotes |
corresponding |
T907 |
856-858 |
IN |
denotes |
to |
T908 |
859-863 |
DT |
denotes |
each |
T910 |
864-868 |
NN |
denotes |
Acdp |
T909 |
869-875 |
NN |
denotes |
member |
T911 |
876-880 |
VBD |
denotes |
were |
T912 |
881-885 |
RB |
denotes |
then |
T905 |
886-896 |
VBN |
denotes |
identified |
T913 |
896-897 |
. |
denotes |
. |
T914 |
897-1011 |
sentence |
denotes |
For example, EST H3086H12-5 corresponds to Acdp1, W98010 for Acdp2, 603299135F1 for Acdp3 and BG083791 for Acdp4. |
T915 |
898-901 |
IN |
denotes |
For |
T917 |
902-909 |
NN |
denotes |
example |
T918 |
909-911 |
, |
denotes |
, |
T919 |
911-914 |
NN |
denotes |
EST |
T920 |
915-923 |
NN |
denotes |
H3086H12 |
T921 |
923-924 |
HYPH |
denotes |
- |
T922 |
924-925 |
CD |
denotes |
5 |
T916 |
926-937 |
VBZ |
denotes |
corresponds |
T923 |
938-940 |
IN |
denotes |
to |
T924 |
941-946 |
NN |
denotes |
Acdp1 |
T925 |
946-948 |
, |
denotes |
, |
T926 |
948-954 |
NN |
denotes |
W98010 |
T927 |
955-958 |
IN |
denotes |
for |
T928 |
959-964 |
NN |
denotes |
Acdp2 |
T929 |
964-966 |
, |
denotes |
, |
T930 |
966-977 |
NN |
denotes |
603299135F1 |
T931 |
978-981 |
IN |
denotes |
for |
T932 |
982-987 |
NN |
denotes |
Acdp3 |
T933 |
988-991 |
CC |
denotes |
and |
T934 |
992-1000 |
NN |
denotes |
BG083791 |
T935 |
1001-1004 |
IN |
denotes |
for |
T936 |
1005-1010 |
NN |
denotes |
Acdp4 |
T937 |
1010-1011 |
. |
denotes |
. |
T938 |
1011-1077 |
sentence |
denotes |
A modified oligo-dT with a M13 tail was used for the RT reaction. |
T939 |
1012-1013 |
DT |
denotes |
A |
T941 |
1014-1022 |
VBN |
denotes |
modified |
T942 |
1023-1028 |
NN |
denotes |
oligo |
T943 |
1028-1029 |
HYPH |
denotes |
- |
T940 |
1029-1031 |
NN |
denotes |
dT |
T945 |
1032-1036 |
IN |
denotes |
with |
T946 |
1037-1038 |
DT |
denotes |
a |
T948 |
1039-1042 |
NN |
denotes |
M13 |
T947 |
1043-1047 |
NN |
denotes |
tail |
T949 |
1048-1051 |
VBD |
denotes |
was |
T944 |
1052-1056 |
VBN |
denotes |
used |
T950 |
1057-1060 |
IN |
denotes |
for |
T951 |
1061-1064 |
DT |
denotes |
the |
T953 |
1065-1067 |
NN |
denotes |
RT |
T952 |
1068-1076 |
NN |
denotes |
reaction |
T954 |
1076-1077 |
. |
denotes |
. |
T955 |
1077-1245 |
sentence |
denotes |
A forward primer from each EST marker and the M13 primer (olig-dT tail) were used to amplify the 3' UTR sequence for each corresponding Acdp gene from the RT products. |
T956 |
1078-1079 |
DT |
denotes |
A |
T958 |
1080-1087 |
JJ |
denotes |
forward |
T957 |
1088-1094 |
NN |
denotes |
primer |
T960 |
1095-1099 |
IN |
denotes |
from |
T961 |
1100-1104 |
DT |
denotes |
each |
T963 |
1105-1108 |
NN |
denotes |
EST |
T962 |
1109-1115 |
NN |
denotes |
marker |
T964 |
1116-1119 |
CC |
denotes |
and |
T965 |
1120-1123 |
DT |
denotes |
the |
T967 |
1124-1127 |
NN |
denotes |
M13 |
T966 |
1128-1134 |
NN |
denotes |
primer |
T968 |
1135-1136 |
-LRB- |
denotes |
( |
T969 |
1136-1140 |
NN |
denotes |
olig |
T971 |
1140-1141 |
HYPH |
denotes |
- |
T970 |
1141-1143 |
NN |
denotes |
dT |
T972 |
1144-1148 |
NN |
denotes |
tail |
T973 |
1148-1149 |
-RRB- |
denotes |
) |
T974 |
1150-1154 |
VBD |
denotes |
were |
T959 |
1155-1159 |
VBN |
denotes |
used |
T975 |
1160-1162 |
TO |
denotes |
to |
T976 |
1163-1170 |
VB |
denotes |
amplify |
T977 |
1171-1174 |
DT |
denotes |
the |
T979 |
1175-1176 |
CD |
denotes |
3 |
T981 |
1176-1177 |
SYM |
denotes |
' |
T980 |
1178-1181 |
NN |
denotes |
UTR |
T978 |
1182-1190 |
NN |
denotes |
sequence |
T982 |
1191-1194 |
IN |
denotes |
for |
T983 |
1195-1199 |
DT |
denotes |
each |
T985 |
1200-1213 |
VBG |
denotes |
corresponding |
T986 |
1214-1218 |
NN |
denotes |
Acdp |
T984 |
1219-1223 |
NN |
denotes |
gene |
T987 |
1224-1228 |
IN |
denotes |
from |
T988 |
1229-1232 |
DT |
denotes |
the |
T990 |
1233-1235 |
NN |
denotes |
RT |
T989 |
1236-1244 |
NNS |
denotes |
products |
T991 |
1244-1245 |
. |
denotes |
. |
T992 |
1245-1378 |
sentence |
denotes |
To obtain 5'-end coding sequences for the Acdp genes, we conducted a series nested PCR with combinations of mouse and human primers. |
T993 |
1246-1248 |
TO |
denotes |
To |
T994 |
1249-1255 |
VB |
denotes |
obtain |
T996 |
1256-1257 |
CD |
denotes |
5 |
T998 |
1257-1258 |
SYM |
denotes |
' |
T999 |
1258-1259 |
HYPH |
denotes |
- |
T997 |
1259-1262 |
NN |
denotes |
end |
T1001 |
1263-1269 |
VBG |
denotes |
coding |
T1000 |
1270-1279 |
NNS |
denotes |
sequences |
T1002 |
1280-1283 |
IN |
denotes |
for |
T1003 |
1284-1287 |
DT |
denotes |
the |
T1005 |
1288-1292 |
NN |
denotes |
Acdp |
T1004 |
1293-1298 |
NNS |
denotes |
genes |
T1006 |
1298-1300 |
, |
denotes |
, |
T1007 |
1300-1302 |
PRP |
denotes |
we |
T995 |
1303-1312 |
VBD |
denotes |
conducted |
T1008 |
1313-1314 |
DT |
denotes |
a |
T1010 |
1315-1321 |
NN |
denotes |
series |
T1011 |
1322-1328 |
VBN |
denotes |
nested |
T1009 |
1329-1332 |
NN |
denotes |
PCR |
T1012 |
1333-1337 |
IN |
denotes |
with |
T1013 |
1338-1350 |
NNS |
denotes |
combinations |
T1014 |
1351-1353 |
IN |
denotes |
of |
T1015 |
1354-1359 |
NN |
denotes |
mouse |
T1017 |
1360-1363 |
CC |
denotes |
and |
T1018 |
1364-1369 |
JJ |
denotes |
human |
T1016 |
1370-1377 |
NNS |
denotes |
primers |
T1019 |
1377-1378 |
. |
denotes |
. |
T1020 |
1378-1487 |
sentence |
denotes |
The 5' UTR sequences were identified by directly sequencing BAC DNA containing the corresponding Acdp genes. |
T1021 |
1379-1382 |
DT |
denotes |
The |
T1023 |
1383-1384 |
CD |
denotes |
5 |
T1024 |
1384-1385 |
SYM |
denotes |
' |
T1025 |
1386-1389 |
NN |
denotes |
UTR |
T1022 |
1390-1399 |
NNS |
denotes |
sequences |
T1027 |
1400-1404 |
VBD |
denotes |
were |
T1026 |
1405-1415 |
VBN |
denotes |
identified |
T1028 |
1416-1418 |
IN |
denotes |
by |
T1029 |
1419-1427 |
RB |
denotes |
directly |
T1030 |
1428-1438 |
VBG |
denotes |
sequencing |
T1031 |
1439-1442 |
NN |
denotes |
BAC |
T1032 |
1443-1446 |
NN |
denotes |
DNA |
T1033 |
1447-1457 |
VBG |
denotes |
containing |
T1034 |
1458-1461 |
DT |
denotes |
the |
T1036 |
1462-1475 |
VBG |
denotes |
corresponding |
T1037 |
1476-1480 |
NN |
denotes |
Acdp |
T1035 |
1481-1486 |
NNS |
denotes |
genes |
T1038 |
1486-1487 |
. |
denotes |
. |
T1039 |
1487-1581 |
sentence |
denotes |
The BAC clones were identified by screening a CITB mouse BAC DNA library (Research Genetics). |
T1040 |
1488-1491 |
DT |
denotes |
The |
T1042 |
1492-1495 |
NN |
denotes |
BAC |
T1041 |
1496-1502 |
NNS |
denotes |
clones |
T1044 |
1503-1507 |
VBD |
denotes |
were |
T1043 |
1508-1518 |
VBN |
denotes |
identified |
T1045 |
1519-1521 |
IN |
denotes |
by |
T1046 |
1522-1531 |
VBG |
denotes |
screening |
T1047 |
1532-1533 |
DT |
denotes |
a |
T1049 |
1534-1538 |
NN |
denotes |
CITB |
T1051 |
1539-1544 |
NN |
denotes |
mouse |
T1052 |
1545-1548 |
NN |
denotes |
BAC |
T1050 |
1549-1552 |
NN |
denotes |
DNA |
T1048 |
1553-1560 |
NN |
denotes |
library |
T1053 |
1561-1562 |
-LRB- |
denotes |
( |
T1055 |
1562-1570 |
NNP |
denotes |
Research |
T1054 |
1571-1579 |
NNP |
denotes |
Genetics |
T1056 |
1579-1580 |
-RRB- |
denotes |
) |
T1057 |
1580-1581 |
. |
denotes |
. |
T1058 |
1581-1656 |
sentence |
denotes |
The 5' UTR sequences obtained from above were further confirmed by RT-PCR. |
T1059 |
1582-1585 |
DT |
denotes |
The |
T1061 |
1586-1587 |
CD |
denotes |
5 |
T1062 |
1587-1588 |
SYM |
denotes |
' |
T1063 |
1589-1592 |
NN |
denotes |
UTR |
T1060 |
1593-1602 |
NNS |
denotes |
sequences |
T1065 |
1603-1611 |
VBN |
denotes |
obtained |
T1066 |
1612-1616 |
IN |
denotes |
from |
T1067 |
1617-1622 |
RB |
denotes |
above |
T1068 |
1623-1627 |
VBD |
denotes |
were |
T1069 |
1628-1635 |
RB |
denotes |
further |
T1064 |
1636-1645 |
VBN |
denotes |
confirmed |
T1070 |
1646-1648 |
IN |
denotes |
by |
T1071 |
1649-1651 |
NN |
denotes |
RT |
T1073 |
1651-1652 |
HYPH |
denotes |
- |
T1072 |
1652-1655 |
NN |
denotes |
PCR |
T1074 |
1655-1656 |
. |
denotes |
. |
T1075 |
1656-1771 |
sentence |
denotes |
The Acdp1 gene contains 3,631 bp of nucleotide sequence and encodes a predicted protein with 951 amino acids (AA). |
T1076 |
1657-1660 |
DT |
denotes |
The |
T1078 |
1661-1666 |
NN |
denotes |
Acdp1 |
T1077 |
1667-1671 |
NN |
denotes |
gene |
T1079 |
1672-1680 |
VBZ |
denotes |
contains |
T1080 |
1681-1686 |
CD |
denotes |
3,631 |
T1081 |
1687-1689 |
NNS |
denotes |
bp |
T1082 |
1690-1692 |
IN |
denotes |
of |
T1083 |
1693-1703 |
NN |
denotes |
nucleotide |
T1084 |
1704-1712 |
NN |
denotes |
sequence |
T1085 |
1713-1716 |
CC |
denotes |
and |
T1086 |
1717-1724 |
VBZ |
denotes |
encodes |
T1087 |
1725-1726 |
DT |
denotes |
a |
T1089 |
1727-1736 |
VBN |
denotes |
predicted |
T1088 |
1737-1744 |
NN |
denotes |
protein |
T1090 |
1745-1749 |
IN |
denotes |
with |
T1091 |
1750-1753 |
CD |
denotes |
951 |
T1093 |
1754-1759 |
NN |
denotes |
amino |
T1092 |
1760-1765 |
NNS |
denotes |
acids |
T1094 |
1766-1767 |
-LRB- |
denotes |
( |
T1095 |
1767-1769 |
NN |
denotes |
AA |
T1096 |
1769-1770 |
-RRB- |
denotes |
) |
T1097 |
1770-1771 |
. |
denotes |
. |
T1098 |
1771-1973 |
sentence |
denotes |
The other three Acdp genes (Acdp2, 3 and 4) contain 3,244 bp, 2,684 bp and 2,743 bp of cDNA sequences, and encode deduced proteins of 874 amino acids, 713 amino acids and 771 amino acids, respectively. |
T1099 |
1772-1775 |
DT |
denotes |
The |
T1101 |
1776-1781 |
JJ |
denotes |
other |
T1102 |
1782-1787 |
CD |
denotes |
three |
T1103 |
1788-1792 |
NN |
denotes |
Acdp |
T1100 |
1793-1798 |
NNS |
denotes |
genes |
T1105 |
1799-1800 |
-LRB- |
denotes |
( |
T1106 |
1800-1805 |
NN |
denotes |
Acdp2 |
T1107 |
1805-1807 |
, |
denotes |
, |
T1108 |
1807-1808 |
CD |
denotes |
3 |
T1109 |
1809-1812 |
CC |
denotes |
and |
T1110 |
1813-1814 |
CD |
denotes |
4 |
T1111 |
1814-1815 |
-RRB- |
denotes |
) |
T1104 |
1816-1823 |
VBP |
denotes |
contain |
T1112 |
1824-1829 |
CD |
denotes |
3,244 |
T1113 |
1830-1832 |
NNS |
denotes |
bp |
T1114 |
1832-1834 |
, |
denotes |
, |
T1115 |
1834-1839 |
CD |
denotes |
2,684 |
T1116 |
1840-1842 |
NNS |
denotes |
bp |
T1117 |
1843-1846 |
CC |
denotes |
and |
T1118 |
1847-1852 |
CD |
denotes |
2,743 |
T1119 |
1853-1855 |
NNS |
denotes |
bp |
T1120 |
1856-1858 |
IN |
denotes |
of |
T1121 |
1859-1863 |
NN |
denotes |
cDNA |
T1122 |
1864-1873 |
NNS |
denotes |
sequences |
T1123 |
1873-1875 |
, |
denotes |
, |
T1124 |
1875-1878 |
CC |
denotes |
and |
T1125 |
1879-1885 |
VBP |
denotes |
encode |
T1126 |
1886-1893 |
VBN |
denotes |
deduced |
T1127 |
1894-1902 |
NN |
denotes |
proteins |
T1128 |
1903-1905 |
IN |
denotes |
of |
T1129 |
1906-1909 |
CD |
denotes |
874 |
T1131 |
1910-1915 |
NN |
denotes |
amino |
T1130 |
1916-1921 |
NNS |
denotes |
acids |
T1132 |
1921-1923 |
, |
denotes |
, |
T1133 |
1923-1926 |
CD |
denotes |
713 |
T1135 |
1927-1932 |
NN |
denotes |
amino |
T1134 |
1933-1938 |
NNS |
denotes |
acids |
T1136 |
1939-1942 |
CC |
denotes |
and |
T1137 |
1943-1946 |
CD |
denotes |
771 |
T1139 |
1947-1952 |
NN |
denotes |
amino |
T1138 |
1953-1958 |
NNS |
denotes |
acids |
T1140 |
1958-1960 |
, |
denotes |
, |
T1141 |
1960-1972 |
RB |
denotes |
respectively |
T1142 |
1972-1973 |
. |
denotes |
. |
T1296 |
1975-1981 |
NN |
denotes |
Tissue |
T1297 |
1982-1994 |
NN |
denotes |
distribution |
T1298 |
1994-2098 |
sentence |
denotes |
Northern blot analyses of the Acdp gene family were carried out using membranes purchased from Origene. |
T1299 |
1995-2003 |
NNP |
denotes |
Northern |
T1300 |
2004-2008 |
NN |
denotes |
blot |
T1301 |
2009-2017 |
NNS |
denotes |
analyses |
T1303 |
2018-2020 |
IN |
denotes |
of |
T1304 |
2021-2024 |
DT |
denotes |
the |
T1306 |
2025-2029 |
NN |
denotes |
Acdp |
T1307 |
2030-2034 |
NN |
denotes |
gene |
T1305 |
2035-2041 |
NN |
denotes |
family |
T1308 |
2042-2046 |
VBD |
denotes |
were |
T1302 |
2047-2054 |
VBN |
denotes |
carried |
T1309 |
2055-2058 |
RP |
denotes |
out |
T1310 |
2059-2064 |
VBG |
denotes |
using |
T1311 |
2065-2074 |
NNS |
denotes |
membranes |
T1312 |
2075-2084 |
VBN |
denotes |
purchased |
T1313 |
2085-2089 |
IN |
denotes |
from |
T1314 |
2090-2097 |
NNP |
denotes |
Origene |
T1315 |
2097-2098 |
. |
denotes |
. |
T1316 |
2098-2163 |
sentence |
denotes |
A total of 12 mouse tissues were included in the study (Fig. 1). |
T1317 |
2099-2100 |
DT |
denotes |
A |
T1318 |
2101-2106 |
NN |
denotes |
total |
T1320 |
2107-2109 |
IN |
denotes |
of |
T1321 |
2110-2112 |
CD |
denotes |
12 |
T1323 |
2113-2118 |
NN |
denotes |
mouse |
T1322 |
2119-2126 |
NNS |
denotes |
tissues |
T1324 |
2127-2131 |
VBD |
denotes |
were |
T1319 |
2132-2140 |
VBN |
denotes |
included |
T1325 |
2141-2143 |
IN |
denotes |
in |
T1326 |
2144-2147 |
DT |
denotes |
the |
T1327 |
2148-2153 |
NN |
denotes |
study |
T1328 |
2154-2155 |
-LRB- |
denotes |
( |
T1329 |
2155-2159 |
NN |
denotes |
Fig. |
T1330 |
2160-2161 |
CD |
denotes |
1 |
T1331 |
2161-2162 |
-RRB- |
denotes |
) |
T1332 |
2162-2163 |
. |
denotes |
. |
T1333 |
2163-2350 |
sentence |
denotes |
Due to sequence homologies between each Acdp member within the conserved domain, probes for Northern bolts were PCR fragments from the last exon and the 3' untranslated region sequences. |
T1334 |
2164-2167 |
IN |
denotes |
Due |
T1336 |
2168-2170 |
IN |
denotes |
to |
T1337 |
2171-2179 |
NN |
denotes |
sequence |
T1338 |
2180-2190 |
NNS |
denotes |
homologies |
T1339 |
2191-2198 |
IN |
denotes |
between |
T1340 |
2199-2203 |
DT |
denotes |
each |
T1342 |
2204-2208 |
NN |
denotes |
Acdp |
T1341 |
2209-2215 |
NN |
denotes |
member |
T1343 |
2216-2222 |
IN |
denotes |
within |
T1344 |
2223-2226 |
DT |
denotes |
the |
T1346 |
2227-2236 |
VBN |
denotes |
conserved |
T1345 |
2237-2243 |
NN |
denotes |
domain |
T1347 |
2243-2245 |
, |
denotes |
, |
T1348 |
2245-2251 |
NNS |
denotes |
probes |
T1349 |
2252-2255 |
IN |
denotes |
for |
T1350 |
2256-2264 |
NNP |
denotes |
Northern |
T1351 |
2265-2270 |
NNS |
denotes |
bolts |
T1335 |
2271-2275 |
VBD |
denotes |
were |
T1352 |
2276-2279 |
NN |
denotes |
PCR |
T1353 |
2280-2289 |
NNS |
denotes |
fragments |
T1354 |
2290-2294 |
IN |
denotes |
from |
T1355 |
2295-2298 |
DT |
denotes |
the |
T1357 |
2299-2303 |
JJ |
denotes |
last |
T1356 |
2304-2308 |
NN |
denotes |
exon |
T1358 |
2309-2312 |
CC |
denotes |
and |
T1359 |
2313-2316 |
DT |
denotes |
the |
T1361 |
2317-2318 |
CD |
denotes |
3 |
T1363 |
2318-2319 |
SYM |
denotes |
' |
T1364 |
2320-2332 |
JJ |
denotes |
untranslated |
T1362 |
2333-2339 |
NN |
denotes |
region |
T1360 |
2340-2349 |
NNS |
denotes |
sequences |
T1365 |
2349-2350 |
. |
denotes |
. |
T1366 |
2350-2443 |
sentence |
denotes |
The mouse Acdp messages showed almost the same tissue distributions as the human ACDP genes. |
T1367 |
2351-2354 |
DT |
denotes |
The |
T1369 |
2355-2360 |
NN |
denotes |
mouse |
T1370 |
2361-2365 |
NN |
denotes |
Acdp |
T1368 |
2366-2374 |
NNS |
denotes |
messages |
T1371 |
2375-2381 |
VBD |
denotes |
showed |
T1372 |
2382-2388 |
RB |
denotes |
almost |
T1374 |
2389-2392 |
DT |
denotes |
the |
T1375 |
2393-2397 |
JJ |
denotes |
same |
T1376 |
2398-2404 |
NN |
denotes |
tissue |
T1373 |
2405-2418 |
NNS |
denotes |
distributions |
T1377 |
2419-2421 |
IN |
denotes |
as |
T1378 |
2422-2425 |
DT |
denotes |
the |
T1380 |
2426-2431 |
JJ |
denotes |
human |
T1381 |
2432-2436 |
NN |
denotes |
ACDP |
T1379 |
2437-2442 |
NNS |
denotes |
genes |
T1382 |
2442-2443 |
. |
denotes |
. |
T1383 |
2443-2553 |
sentence |
denotes |
Acdp1 message is highly expressed in the brain, while kidney and testis also showed low levels of expression. |
T1384 |
2444-2449 |
NN |
denotes |
Acdp1 |
T1385 |
2450-2457 |
NN |
denotes |
message |
T1387 |
2458-2460 |
VBZ |
denotes |
is |
T1388 |
2461-2467 |
RB |
denotes |
highly |
T1386 |
2468-2477 |
VBN |
denotes |
expressed |
T1389 |
2478-2480 |
IN |
denotes |
in |
T1390 |
2481-2484 |
DT |
denotes |
the |
T1391 |
2485-2490 |
NN |
denotes |
brain |
T1392 |
2490-2492 |
, |
denotes |
, |
T1393 |
2492-2497 |
IN |
denotes |
while |
T1395 |
2498-2504 |
NN |
denotes |
kidney |
T1396 |
2505-2508 |
CC |
denotes |
and |
T1397 |
2509-2515 |
NN |
denotes |
testis |
T1398 |
2516-2520 |
RB |
denotes |
also |
T1394 |
2521-2527 |
VBD |
denotes |
showed |
T1399 |
2528-2531 |
JJ |
denotes |
low |
T1400 |
2532-2538 |
NNS |
denotes |
levels |
T1401 |
2539-2541 |
IN |
denotes |
of |
T1402 |
2542-2552 |
NN |
denotes |
expression |
T1403 |
2552-2553 |
. |
denotes |
. |
T1404 |
2553-2617 |
sentence |
denotes |
Acdp2 showed higher expressions in the brain, kidney and liver. |
T1405 |
2554-2559 |
NN |
denotes |
Acdp2 |
T1406 |
2560-2566 |
VBD |
denotes |
showed |
T1407 |
2567-2573 |
JJR |
denotes |
higher |
T1408 |
2574-2585 |
NNS |
denotes |
expressions |
T1409 |
2586-2588 |
IN |
denotes |
in |
T1410 |
2589-2592 |
DT |
denotes |
the |
T1411 |
2593-2598 |
NN |
denotes |
brain |
T1412 |
2598-2600 |
, |
denotes |
, |
T1413 |
2600-2606 |
NN |
denotes |
kidney |
T1414 |
2607-2610 |
CC |
denotes |
and |
T1415 |
2611-2616 |
NN |
denotes |
liver |
T1416 |
2616-2617 |
. |
denotes |
. |
T1417 |
2617-2764 |
sentence |
denotes |
However, the Acdp2 transcript was not present in the skeleton muscle and skin, and it showed very low levels of expression in the rest of tissues. |
T1418 |
2618-2625 |
RB |
denotes |
However |
T1420 |
2625-2627 |
, |
denotes |
, |
T1421 |
2627-2630 |
DT |
denotes |
the |
T1423 |
2631-2636 |
NN |
denotes |
Acdp2 |
T1422 |
2637-2647 |
NN |
denotes |
transcript |
T1419 |
2648-2651 |
VBD |
denotes |
was |
T1424 |
2652-2655 |
RB |
denotes |
not |
T1425 |
2656-2663 |
JJ |
denotes |
present |
T1426 |
2664-2666 |
IN |
denotes |
in |
T1427 |
2667-2670 |
DT |
denotes |
the |
T1429 |
2671-2679 |
NN |
denotes |
skeleton |
T1428 |
2680-2686 |
NN |
denotes |
muscle |
T1430 |
2687-2690 |
CC |
denotes |
and |
T1431 |
2691-2695 |
NN |
denotes |
skin |
T1432 |
2695-2697 |
, |
denotes |
, |
T1433 |
2697-2700 |
CC |
denotes |
and |
T1434 |
2701-2703 |
PRP |
denotes |
it |
T1435 |
2704-2710 |
VBD |
denotes |
showed |
T1436 |
2711-2715 |
RB |
denotes |
very |
T1437 |
2716-2719 |
JJ |
denotes |
low |
T1438 |
2720-2726 |
NNS |
denotes |
levels |
T1439 |
2727-2729 |
IN |
denotes |
of |
T1440 |
2730-2740 |
NN |
denotes |
expression |
T1441 |
2741-2743 |
IN |
denotes |
in |
T1442 |
2744-2747 |
DT |
denotes |
the |
T1443 |
2748-2752 |
NN |
denotes |
rest |
T1444 |
2753-2755 |
IN |
denotes |
of |
T1445 |
2756-2763 |
NNS |
denotes |
tissues |
T1446 |
2763-2764 |
. |
denotes |
. |
T1447 |
2764-3023 |
sentence |
denotes |
Acdp3 and Acdp4 showed different levels of expression in all tissues tested; the highest expressions for Acdp3 were observed in the brain, kidney, liver and heart, and the highest expressions for Acdp4 were observed in the kidney, small intestine and testis. |
T1448 |
2765-2770 |
NN |
denotes |
Acdp3 |
T1450 |
2771-2774 |
CC |
denotes |
and |
T1451 |
2775-2780 |
NN |
denotes |
Acdp4 |
T1449 |
2781-2787 |
VBD |
denotes |
showed |
T1453 |
2788-2797 |
JJ |
denotes |
different |
T1454 |
2798-2804 |
NNS |
denotes |
levels |
T1455 |
2805-2807 |
IN |
denotes |
of |
T1456 |
2808-2818 |
NN |
denotes |
expression |
T1457 |
2819-2821 |
IN |
denotes |
in |
T1458 |
2822-2825 |
DT |
denotes |
all |
T1459 |
2826-2833 |
NNS |
denotes |
tissues |
T1460 |
2834-2840 |
VBN |
denotes |
tested |
T1461 |
2840-2841 |
: |
denotes |
; |
T1462 |
2842-2845 |
DT |
denotes |
the |
T1464 |
2846-2853 |
JJS |
denotes |
highest |
T1463 |
2854-2865 |
NNS |
denotes |
expressions |
T1465 |
2866-2869 |
IN |
denotes |
for |
T1466 |
2870-2875 |
NN |
denotes |
Acdp3 |
T1467 |
2876-2880 |
VBD |
denotes |
were |
T1452 |
2881-2889 |
VBN |
denotes |
observed |
T1468 |
2890-2892 |
IN |
denotes |
in |
T1469 |
2893-2896 |
DT |
denotes |
the |
T1470 |
2897-2902 |
NN |
denotes |
brain |
T1471 |
2902-2904 |
, |
denotes |
, |
T1472 |
2904-2910 |
NN |
denotes |
kidney |
T1473 |
2910-2912 |
, |
denotes |
, |
T1474 |
2912-2917 |
NN |
denotes |
liver |
T1475 |
2918-2921 |
CC |
denotes |
and |
T1476 |
2922-2927 |
NN |
denotes |
heart |
T1477 |
2927-2929 |
, |
denotes |
, |
T1478 |
2929-2932 |
CC |
denotes |
and |
T1479 |
2933-2936 |
DT |
denotes |
the |
T1481 |
2937-2944 |
JJS |
denotes |
highest |
T1480 |
2945-2956 |
NNS |
denotes |
expressions |
T1483 |
2957-2960 |
IN |
denotes |
for |
T1484 |
2961-2966 |
NN |
denotes |
Acdp4 |
T1485 |
2967-2971 |
VBD |
denotes |
were |
T1482 |
2972-2980 |
VBN |
denotes |
observed |
T1486 |
2981-2983 |
IN |
denotes |
in |
T1487 |
2984-2987 |
DT |
denotes |
the |
T1488 |
2988-2994 |
NN |
denotes |
kidney |
T1489 |
2994-2996 |
, |
denotes |
, |
T1490 |
2996-3001 |
JJ |
denotes |
small |
T1491 |
3002-3011 |
NN |
denotes |
intestine |
T1492 |
3012-3015 |
CC |
denotes |
and |
T1493 |
3016-3022 |
NN |
denotes |
testis |
T1494 |
3022-3023 |
. |
denotes |
. |
T1495 |
3023-3234 |
sentence |
denotes |
The expression levels for Acdp3 and 4 in skeleton muscle were barely detectable; however, β-actin showed normal expression suggesting that the results were not a consequence of bad RNA quality (data not shown). |
T1496 |
3024-3027 |
DT |
denotes |
The |
T1498 |
3028-3038 |
NN |
denotes |
expression |
T1497 |
3039-3045 |
NNS |
denotes |
levels |
T1500 |
3046-3049 |
IN |
denotes |
for |
T1501 |
3050-3055 |
NN |
denotes |
Acdp3 |
T1502 |
3056-3059 |
CC |
denotes |
and |
T1503 |
3060-3061 |
CD |
denotes |
4 |
T1504 |
3062-3064 |
IN |
denotes |
in |
T1505 |
3065-3073 |
NN |
denotes |
skeleton |
T1506 |
3074-3080 |
NN |
denotes |
muscle |
T1499 |
3081-3085 |
VBD |
denotes |
were |
T1508 |
3086-3092 |
RB |
denotes |
barely |
T1509 |
3093-3103 |
JJ |
denotes |
detectable |
T1510 |
3103-3104 |
: |
denotes |
; |
T1511 |
3105-3112 |
RB |
denotes |
however |
T1512 |
3112-3114 |
, |
denotes |
, |
T1513 |
3114-3115 |
NN |
denotes |
β |
T1515 |
3115-3116 |
HYPH |
denotes |
- |
T1514 |
3116-3121 |
NN |
denotes |
actin |
T1507 |
3122-3128 |
VBD |
denotes |
showed |
T1516 |
3129-3135 |
JJ |
denotes |
normal |
T1517 |
3136-3146 |
NN |
denotes |
expression |
T1518 |
3147-3157 |
VBG |
denotes |
suggesting |
T1519 |
3158-3162 |
IN |
denotes |
that |
T1521 |
3163-3166 |
DT |
denotes |
the |
T1522 |
3167-3174 |
NNS |
denotes |
results |
T1520 |
3175-3179 |
VBD |
denotes |
were |
T1523 |
3180-3183 |
RB |
denotes |
not |
T1524 |
3184-3185 |
DT |
denotes |
a |
T1525 |
3186-3197 |
NN |
denotes |
consequence |
T1526 |
3198-3200 |
IN |
denotes |
of |
T1527 |
3201-3204 |
JJ |
denotes |
bad |
T1529 |
3205-3208 |
NN |
denotes |
RNA |
T1528 |
3209-3216 |
NN |
denotes |
quality |
T1530 |
3217-3218 |
-LRB- |
denotes |
( |
T1532 |
3218-3222 |
NNS |
denotes |
data |
T1533 |
3223-3226 |
RB |
denotes |
not |
T1531 |
3227-3232 |
VBN |
denotes |
shown |
T1534 |
3232-3233 |
-RRB- |
denotes |
) |
T1535 |
3233-3234 |
. |
denotes |
. |
T1536 |
3234-3463 |
sentence |
denotes |
The ubiquitous expression pattern may be taken as another indication of the functional importance of Acdp proteins in fundamental biological processes in addition to the sequence conservation in evolutionarily divergent species. |
T1537 |
3235-3238 |
DT |
denotes |
The |
T1539 |
3239-3249 |
JJ |
denotes |
ubiquitous |
T1540 |
3250-3260 |
NN |
denotes |
expression |
T1538 |
3261-3268 |
NN |
denotes |
pattern |
T1542 |
3269-3272 |
MD |
denotes |
may |
T1543 |
3273-3275 |
VB |
denotes |
be |
T1541 |
3276-3281 |
VBN |
denotes |
taken |
T1544 |
3282-3284 |
IN |
denotes |
as |
T1545 |
3285-3292 |
DT |
denotes |
another |
T1546 |
3293-3303 |
NN |
denotes |
indication |
T1547 |
3304-3306 |
IN |
denotes |
of |
T1548 |
3307-3310 |
DT |
denotes |
the |
T1550 |
3311-3321 |
JJ |
denotes |
functional |
T1549 |
3322-3332 |
NN |
denotes |
importance |
T1551 |
3333-3335 |
IN |
denotes |
of |
T1552 |
3336-3340 |
NN |
denotes |
Acdp |
T1553 |
3341-3349 |
NN |
denotes |
proteins |
T1554 |
3350-3352 |
IN |
denotes |
in |
T1555 |
3353-3364 |
JJ |
denotes |
fundamental |
T1557 |
3365-3375 |
JJ |
denotes |
biological |
T1556 |
3376-3385 |
NNS |
denotes |
processes |
T1558 |
3386-3388 |
IN |
denotes |
in |
T1559 |
3389-3397 |
NN |
denotes |
addition |
T1560 |
3398-3400 |
IN |
denotes |
to |
T1561 |
3401-3404 |
DT |
denotes |
the |
T1563 |
3405-3413 |
NN |
denotes |
sequence |
T1562 |
3414-3426 |
NN |
denotes |
conservation |
T1564 |
3427-3429 |
IN |
denotes |
in |
T1565 |
3430-3444 |
RB |
denotes |
evolutionarily |
T1566 |
3445-3454 |
JJ |
denotes |
divergent |
T1567 |
3455-3462 |
NNS |
denotes |
species |
T1568 |
3462-3463 |
. |
denotes |
. |
T5731 |
3474-3482 |
NNP |
denotes |
Northern |
T5732 |
3483-3487 |
NN |
denotes |
blot |
T5733 |
3488-3496 |
NNS |
denotes |
analyses |
T5734 |
3497-3499 |
IN |
denotes |
of |
T5735 |
3500-3503 |
DT |
denotes |
the |
T5737 |
3504-3508 |
NN |
denotes |
Acdp |
T5738 |
3509-3513 |
NN |
denotes |
gene |
T5736 |
3514-3520 |
NN |
denotes |
family |
T5739 |
3520-3521 |
. |
denotes |
. |
T5740 |
3521-3563 |
sentence |
denotes |
S. muscle represents skeletal muscle, Sm. |
T5741 |
3522-3524 |
NN |
denotes |
S. |
T5742 |
3525-3531 |
NN |
denotes |
muscle |
T5743 |
3532-3542 |
VBZ |
denotes |
represents |
T5744 |
3543-3551 |
JJ |
denotes |
skeletal |
T5745 |
3552-3558 |
NN |
denotes |
muscle |
T5746 |
3558-3560 |
, |
denotes |
, |
T5747 |
3560-3562 |
NN |
denotes |
Sm |
T5748 |
3562-3563 |
. |
denotes |
. |
T5749 |
3563-3596 |
sentence |
denotes |
Int. represents small intestine. |
T5750 |
3564-3568 |
NN |
denotes |
Int. |
T5751 |
3569-3579 |
VBZ |
denotes |
represents |
T5752 |
3580-3585 |
JJ |
denotes |
small |
T5753 |
3586-3595 |
NN |
denotes |
intestine |
T5754 |
3595-3596 |
. |
denotes |
. |
T5755 |
3596-3663 |
sentence |
denotes |
Multiple Choice Northern Blot filters were purchased from Origene. |
T5756 |
3597-3605 |
JJ |
denotes |
Multiple |
T5757 |
3606-3612 |
NN |
denotes |
Choice |
T5759 |
3613-3621 |
NNP |
denotes |
Northern |
T5758 |
3622-3626 |
NN |
denotes |
Blot |
T5760 |
3627-3634 |
NNS |
denotes |
filters |
T5762 |
3635-3639 |
VBD |
denotes |
were |
T5761 |
3640-3649 |
VBN |
denotes |
purchased |
T5763 |
3650-3654 |
IN |
denotes |
from |
T5764 |
3655-3662 |
NNP |
denotes |
Origene |
T5765 |
3662-3663 |
. |
denotes |
. |
T1609 |
3665-3676 |
JJ |
denotes |
Chromosomal |
T1610 |
3677-3685 |
NN |
denotes |
location |
T1611 |
3685-3838 |
sentence |
denotes |
Radiation hybrid mapping indicated that the Acdp1 gene maps to chromosome 19 between markers D19Mit119 (34.3 cR proximal)and D19Mit112 (13.6 cR distal). |
T1612 |
3686-3695 |
NN |
denotes |
Radiation |
T1614 |
3696-3702 |
NN |
denotes |
hybrid |
T1613 |
3703-3710 |
NN |
denotes |
mapping |
T1615 |
3711-3720 |
VBD |
denotes |
indicated |
T1616 |
3721-3725 |
IN |
denotes |
that |
T1618 |
3726-3729 |
DT |
denotes |
the |
T1620 |
3730-3735 |
NN |
denotes |
Acdp1 |
T1619 |
3736-3740 |
NN |
denotes |
gene |
T1617 |
3741-3745 |
VBZ |
denotes |
maps |
T1621 |
3746-3748 |
IN |
denotes |
to |
T1622 |
3749-3759 |
NN |
denotes |
chromosome |
T1623 |
3760-3762 |
CD |
denotes |
19 |
T1624 |
3763-3770 |
IN |
denotes |
between |
T1625 |
3771-3778 |
NNS |
denotes |
markers |
T1626 |
3779-3788 |
NN |
denotes |
D19Mit119 |
T1627 |
3789-3790 |
-LRB- |
denotes |
( |
T1629 |
3790-3794 |
CD |
denotes |
34.3 |
T1628 |
3795-3797 |
NN |
denotes |
cR |
T1630 |
3798-3806 |
JJ |
denotes |
proximal |
T1631 |
3806-3807 |
-RRB- |
denotes |
) |
T1632 |
3807-3810 |
CC |
denotes |
and |
T1633 |
3811-3820 |
NN |
denotes |
D19Mit112 |
T1634 |
3821-3822 |
-LRB- |
denotes |
( |
T1636 |
3822-3826 |
CD |
denotes |
13.6 |
T1635 |
3827-3829 |
NN |
denotes |
cR |
T1637 |
3830-3836 |
JJ |
denotes |
distal |
T1638 |
3836-3837 |
-RRB- |
denotes |
) |
T1639 |
3837-3838 |
. |
denotes |
. |
T1640 |
3838-3974 |
sentence |
denotes |
The Acdp2 gene maps slightly more distal to the Acdp1 on chromosome 19 between D19Mit9 (2.4 cR proximal) and D19Mit38 (15.1 cR distal). |
T1641 |
3839-3842 |
DT |
denotes |
The |
T1643 |
3843-3848 |
NN |
denotes |
Acdp2 |
T1642 |
3849-3853 |
NN |
denotes |
gene |
T1644 |
3854-3858 |
VBZ |
denotes |
maps |
T1645 |
3859-3867 |
RB |
denotes |
slightly |
T1646 |
3868-3872 |
RBR |
denotes |
more |
T1647 |
3873-3879 |
JJ |
denotes |
distal |
T1648 |
3880-3882 |
IN |
denotes |
to |
T1649 |
3883-3886 |
DT |
denotes |
the |
T1650 |
3887-3892 |
NN |
denotes |
Acdp1 |
T1651 |
3893-3895 |
IN |
denotes |
on |
T1652 |
3896-3906 |
NN |
denotes |
chromosome |
T1653 |
3907-3909 |
CD |
denotes |
19 |
T1654 |
3910-3917 |
IN |
denotes |
between |
T1655 |
3918-3925 |
NN |
denotes |
D19Mit9 |
T1656 |
3926-3927 |
-LRB- |
denotes |
( |
T1658 |
3927-3930 |
CD |
denotes |
2.4 |
T1657 |
3931-3933 |
NN |
denotes |
cR |
T1659 |
3934-3942 |
JJ |
denotes |
proximal |
T1660 |
3942-3943 |
-RRB- |
denotes |
) |
T1661 |
3944-3947 |
CC |
denotes |
and |
T1662 |
3948-3956 |
NN |
denotes |
D19Mit38 |
T1663 |
3957-3958 |
-LRB- |
denotes |
( |
T1665 |
3958-3962 |
CD |
denotes |
15.1 |
T1664 |
3963-3965 |
NN |
denotes |
cR |
T1666 |
3966-3972 |
JJ |
denotes |
distal |
T1667 |
3972-3973 |
-RRB- |
denotes |
) |
T1668 |
3973-3974 |
. |
denotes |
. |
T1669 |
3974-4095 |
sentence |
denotes |
The Acdp3 and Acdp4 genes map to chromosome 1 within one BAC clone (RP23-294I17), proximal to marker D1Mit171 (17.4 cR). |
T1670 |
3975-3978 |
DT |
denotes |
The |
T1672 |
3979-3984 |
NN |
denotes |
Acdp3 |
T1673 |
3985-3988 |
CC |
denotes |
and |
T1674 |
3989-3994 |
NN |
denotes |
Acdp4 |
T1671 |
3995-4000 |
NNS |
denotes |
genes |
T1675 |
4001-4004 |
VBP |
denotes |
map |
T1676 |
4005-4007 |
IN |
denotes |
to |
T1677 |
4008-4018 |
NN |
denotes |
chromosome |
T1678 |
4019-4020 |
CD |
denotes |
1 |
T1679 |
4021-4027 |
IN |
denotes |
within |
T1680 |
4028-4031 |
CD |
denotes |
one |
T1682 |
4032-4035 |
NN |
denotes |
BAC |
T1681 |
4036-4041 |
NN |
denotes |
clone |
T1683 |
4042-4043 |
-LRB- |
denotes |
( |
T1685 |
4043-4047 |
NN |
denotes |
RP23 |
T1686 |
4047-4048 |
HYPH |
denotes |
- |
T1684 |
4048-4054 |
NN |
denotes |
294I17 |
T1687 |
4054-4055 |
-RRB- |
denotes |
) |
T1688 |
4055-4057 |
, |
denotes |
, |
T1689 |
4057-4065 |
JJ |
denotes |
proximal |
T1690 |
4066-4068 |
IN |
denotes |
to |
T1691 |
4069-4075 |
NN |
denotes |
marker |
T1692 |
4076-4084 |
NN |
denotes |
D1Mit171 |
T1693 |
4085-4086 |
-LRB- |
denotes |
( |
T1695 |
4086-4090 |
CD |
denotes |
17.4 |
T1694 |
4091-4093 |
NN |
denotes |
cR |
T1696 |
4093-4094 |
-RRB- |
denotes |
) |
T1697 |
4094-4095 |
. |
denotes |
. |
T1698 |
4095-4149 |
sentence |
denotes |
These regions are syntenic to the human counterparts. |
T1699 |
4096-4101 |
DT |
denotes |
These |
T1700 |
4102-4109 |
NNS |
denotes |
regions |
T1701 |
4110-4113 |
VBP |
denotes |
are |
T1702 |
4114-4122 |
JJ |
denotes |
syntenic |
T1703 |
4123-4125 |
IN |
denotes |
to |
T1704 |
4126-4129 |
DT |
denotes |
the |
T1706 |
4130-4135 |
JJ |
denotes |
human |
T1705 |
4136-4148 |
NNS |
denotes |
counterparts |
T1707 |
4148-4149 |
. |
denotes |
. |
T2019 |
4151-4159 |
NN |
denotes |
Sequence |
T2020 |
4160-4168 |
NN |
denotes |
homology |
T2021 |
4169-4172 |
CC |
denotes |
and |
T2022 |
4173-4182 |
JJ |
denotes |
molecular |
T2023 |
4183-4198 |
NNS |
denotes |
characteristics |
T2024 |
4198-4320 |
sentence |
denotes |
The mouse Acdp genes showed very strong homologies of both nucleotide and AA sequences to the human ACDP genes (Table 1). |
T2025 |
4199-4202 |
DT |
denotes |
The |
T2027 |
4203-4208 |
NN |
denotes |
mouse |
T2028 |
4209-4213 |
NN |
denotes |
Acdp |
T2026 |
4214-4219 |
NNS |
denotes |
genes |
T2029 |
4220-4226 |
VBD |
denotes |
showed |
T2030 |
4227-4231 |
RB |
denotes |
very |
T2031 |
4232-4238 |
JJ |
denotes |
strong |
T2032 |
4239-4249 |
NNS |
denotes |
homologies |
T2033 |
4250-4252 |
IN |
denotes |
of |
T2034 |
4253-4257 |
CC |
denotes |
both |
T2035 |
4258-4268 |
NN |
denotes |
nucleotide |
T2037 |
4269-4272 |
CC |
denotes |
and |
T2038 |
4273-4275 |
NN |
denotes |
AA |
T2036 |
4276-4285 |
NNS |
denotes |
sequences |
T2039 |
4286-4288 |
IN |
denotes |
to |
T2040 |
4289-4292 |
DT |
denotes |
the |
T2042 |
4293-4298 |
JJ |
denotes |
human |
T2043 |
4299-4303 |
NN |
denotes |
ACDP |
T2041 |
4304-4309 |
NNS |
denotes |
genes |
T2044 |
4310-4311 |
-LRB- |
denotes |
( |
T2045 |
4311-4316 |
NN |
denotes |
Table |
T2046 |
4317-4318 |
CD |
denotes |
1 |
T2047 |
4318-4319 |
-RRB- |
denotes |
) |
T2048 |
4319-4320 |
. |
denotes |
. |
T2049 |
4320-4481 |
sentence |
denotes |
The highest homologies were observed between the human ACDP2 and the mouse Acdp2 gene (91% of nucleotide identity, 97% of AA identity and 99.4% of AA homology). |
T2050 |
4321-4324 |
DT |
denotes |
The |
T2052 |
4325-4332 |
JJS |
denotes |
highest |
T2051 |
4333-4343 |
NNS |
denotes |
homologies |
T2054 |
4344-4348 |
VBD |
denotes |
were |
T2053 |
4349-4357 |
VBN |
denotes |
observed |
T2055 |
4358-4365 |
IN |
denotes |
between |
T2056 |
4366-4369 |
DT |
denotes |
the |
T2058 |
4370-4375 |
JJ |
denotes |
human |
T2057 |
4376-4381 |
NN |
denotes |
ACDP2 |
T2059 |
4382-4385 |
CC |
denotes |
and |
T2060 |
4386-4389 |
DT |
denotes |
the |
T2062 |
4390-4395 |
NN |
denotes |
mouse |
T2061 |
4396-4401 |
NN |
denotes |
Acdp2 |
T2063 |
4402-4406 |
NN |
denotes |
gene |
T2064 |
4407-4408 |
-LRB- |
denotes |
( |
T2066 |
4408-4410 |
CD |
denotes |
91 |
T2065 |
4410-4411 |
NN |
denotes |
% |
T2067 |
4412-4414 |
IN |
denotes |
of |
T2068 |
4415-4425 |
NN |
denotes |
nucleotide |
T2069 |
4426-4434 |
NN |
denotes |
identity |
T2070 |
4434-4436 |
, |
denotes |
, |
T2071 |
4436-4438 |
CD |
denotes |
97 |
T2072 |
4438-4439 |
NN |
denotes |
% |
T2073 |
4440-4442 |
IN |
denotes |
of |
T2074 |
4443-4445 |
NN |
denotes |
AA |
T2075 |
4446-4454 |
NN |
denotes |
identity |
T2076 |
4455-4458 |
CC |
denotes |
and |
T2077 |
4459-4463 |
CD |
denotes |
99.4 |
T2078 |
4463-4464 |
NN |
denotes |
% |
T2079 |
4465-4467 |
IN |
denotes |
of |
T2080 |
4468-4470 |
NN |
denotes |
AA |
T2081 |
4471-4479 |
NN |
denotes |
homology |
T2082 |
4479-4480 |
-RRB- |
denotes |
) |
T2083 |
4480-4481 |
. |
denotes |
. |
T2084 |
4481-4702 |
sentence |
denotes |
In addition, the 5' UTR nucleotide sequences (20 bp of nucleotides before start codon) also showed high homologies to the human homologs, for example, the Acdp2 5' UTR sequence showed 95% identities to its human homolog. |
T2085 |
4482-4484 |
IN |
denotes |
In |
T2087 |
4485-4493 |
NN |
denotes |
addition |
T2088 |
4493-4495 |
, |
denotes |
, |
T2089 |
4495-4498 |
DT |
denotes |
the |
T2091 |
4499-4500 |
CD |
denotes |
5 |
T2093 |
4500-4501 |
SYM |
denotes |
' |
T2092 |
4502-4505 |
NN |
denotes |
UTR |
T2094 |
4506-4516 |
NN |
denotes |
nucleotide |
T2090 |
4517-4526 |
NNS |
denotes |
sequences |
T2095 |
4527-4528 |
-LRB- |
denotes |
( |
T2097 |
4528-4530 |
CD |
denotes |
20 |
T2096 |
4531-4533 |
NNS |
denotes |
bp |
T2098 |
4534-4536 |
IN |
denotes |
of |
T2099 |
4537-4548 |
NNS |
denotes |
nucleotides |
T2100 |
4549-4555 |
IN |
denotes |
before |
T2101 |
4556-4561 |
NN |
denotes |
start |
T2102 |
4562-4567 |
NN |
denotes |
codon |
T2103 |
4567-4568 |
-RRB- |
denotes |
) |
T2104 |
4569-4573 |
RB |
denotes |
also |
T2086 |
4574-4580 |
VBD |
denotes |
showed |
T2106 |
4581-4585 |
JJ |
denotes |
high |
T2107 |
4586-4596 |
NNS |
denotes |
homologies |
T2108 |
4597-4599 |
IN |
denotes |
to |
T2109 |
4600-4603 |
DT |
denotes |
the |
T2111 |
4604-4609 |
JJ |
denotes |
human |
T2110 |
4610-4618 |
NNS |
denotes |
homologs |
T2112 |
4618-4620 |
, |
denotes |
, |
T2113 |
4620-4623 |
IN |
denotes |
for |
T2114 |
4624-4631 |
NN |
denotes |
example |
T2115 |
4631-4633 |
, |
denotes |
, |
T2116 |
4633-4636 |
DT |
denotes |
the |
T2118 |
4637-4642 |
NN |
denotes |
Acdp2 |
T2119 |
4643-4644 |
CD |
denotes |
5 |
T2121 |
4644-4645 |
SYM |
denotes |
' |
T2120 |
4646-4649 |
NN |
denotes |
UTR |
T2117 |
4650-4658 |
NN |
denotes |
sequence |
T2105 |
4659-4665 |
VBD |
denotes |
showed |
T2122 |
4666-4668 |
CD |
denotes |
95 |
T2123 |
4668-4669 |
NN |
denotes |
% |
T2124 |
4670-4680 |
NNS |
denotes |
identities |
T2125 |
4681-4683 |
IN |
denotes |
to |
T2126 |
4684-4687 |
PRP$ |
denotes |
its |
T2128 |
4688-4693 |
JJ |
denotes |
human |
T2127 |
4694-4701 |
NN |
denotes |
homolog |
T2129 |
4701-4702 |
. |
denotes |
. |
T2130 |
4702-4884 |
sentence |
denotes |
However, the homologies in the 3' UTR sequences (20 bp of nucleotides after stop codon) were much lower (40–55%) for all Acdp genes except Acdp4 (90% identity to its human homolog). |
T2131 |
4703-4710 |
RB |
denotes |
However |
T2133 |
4710-4712 |
, |
denotes |
, |
T2134 |
4712-4715 |
DT |
denotes |
the |
T2135 |
4716-4726 |
NNS |
denotes |
homologies |
T2136 |
4727-4729 |
IN |
denotes |
in |
T2137 |
4730-4733 |
DT |
denotes |
the |
T2139 |
4734-4735 |
CD |
denotes |
3 |
T2141 |
4735-4736 |
SYM |
denotes |
' |
T2140 |
4737-4740 |
NN |
denotes |
UTR |
T2138 |
4741-4750 |
NNS |
denotes |
sequences |
T2142 |
4751-4752 |
-LRB- |
denotes |
( |
T2144 |
4752-4754 |
CD |
denotes |
20 |
T2143 |
4755-4757 |
NNS |
denotes |
bp |
T2145 |
4758-4760 |
IN |
denotes |
of |
T2146 |
4761-4772 |
NNS |
denotes |
nucleotides |
T2147 |
4773-4778 |
IN |
denotes |
after |
T2148 |
4779-4783 |
NN |
denotes |
stop |
T2149 |
4784-4789 |
NN |
denotes |
codon |
T2150 |
4789-4790 |
-RRB- |
denotes |
) |
T2132 |
4791-4795 |
VBD |
denotes |
were |
T2151 |
4796-4800 |
RB |
denotes |
much |
T2152 |
4801-4806 |
JJR |
denotes |
lower |
T2153 |
4807-4808 |
-LRB- |
denotes |
( |
T2155 |
4808-4810 |
CD |
denotes |
40 |
T2157 |
4810-4811 |
SYM |
denotes |
– |
T2156 |
4811-4813 |
CD |
denotes |
55 |
T2154 |
4813-4814 |
NN |
denotes |
% |
T2158 |
4814-4815 |
-RRB- |
denotes |
) |
T2159 |
4816-4819 |
IN |
denotes |
for |
T2160 |
4820-4823 |
DT |
denotes |
all |
T2162 |
4824-4828 |
NN |
denotes |
Acdp |
T2161 |
4829-4834 |
NNS |
denotes |
genes |
T2163 |
4835-4841 |
IN |
denotes |
except |
T2164 |
4842-4847 |
NN |
denotes |
Acdp4 |
T2165 |
4848-4849 |
-LRB- |
denotes |
( |
T2167 |
4849-4851 |
CD |
denotes |
90 |
T2168 |
4851-4852 |
NN |
denotes |
% |
T2166 |
4853-4861 |
NN |
denotes |
identity |
T2169 |
4862-4864 |
IN |
denotes |
to |
T2170 |
4865-4868 |
PRP$ |
denotes |
its |
T2172 |
4869-4874 |
JJ |
denotes |
human |
T2171 |
4875-4882 |
NN |
denotes |
homolog |
T2173 |
4882-4883 |
-RRB- |
denotes |
) |
T2174 |
4883-4884 |
. |
denotes |
. |
T2175 |
4884-5018 |
sentence |
denotes |
The ancient conserved domain (ACD) has 55.3% of AA identity and 83.3% of homology between all mouse and human ACDP proteins (Fig. 2). |
T2176 |
4885-4888 |
DT |
denotes |
The |
T2178 |
4889-4896 |
JJ |
denotes |
ancient |
T2179 |
4897-4906 |
VBN |
denotes |
conserved |
T2177 |
4907-4913 |
NN |
denotes |
domain |
T2181 |
4914-4915 |
-LRB- |
denotes |
( |
T2182 |
4915-4918 |
NN |
denotes |
ACD |
T2183 |
4918-4919 |
-RRB- |
denotes |
) |
T2180 |
4920-4923 |
VBZ |
denotes |
has |
T2184 |
4924-4928 |
CD |
denotes |
55.3 |
T2185 |
4928-4929 |
NN |
denotes |
% |
T2186 |
4930-4932 |
IN |
denotes |
of |
T2187 |
4933-4935 |
NN |
denotes |
AA |
T2188 |
4936-4944 |
NN |
denotes |
identity |
T2189 |
4945-4948 |
CC |
denotes |
and |
T2190 |
4949-4953 |
CD |
denotes |
83.3 |
T2191 |
4953-4954 |
NN |
denotes |
% |
T2192 |
4955-4957 |
IN |
denotes |
of |
T2193 |
4958-4966 |
NN |
denotes |
homology |
T2194 |
4967-4974 |
IN |
denotes |
between |
T2195 |
4975-4978 |
DT |
denotes |
all |
T2197 |
4979-4984 |
NN |
denotes |
mouse |
T2198 |
4985-4988 |
CC |
denotes |
and |
T2199 |
4989-4994 |
JJ |
denotes |
human |
T2200 |
4995-4999 |
NN |
denotes |
ACDP |
T2196 |
5000-5008 |
NN |
denotes |
proteins |
T2201 |
5009-5010 |
-LRB- |
denotes |
( |
T2202 |
5010-5014 |
NN |
denotes |
Fig. |
T2203 |
5015-5016 |
CD |
denotes |
2 |
T2204 |
5016-5017 |
-RRB- |
denotes |
) |
T2205 |
5017-5018 |
. |
denotes |
. |
T2206 |
5018-5166 |
sentence |
denotes |
The ACD domain is evolutionarily conserved in divergent species ranging from bacteria, yeast, C. elegans, D. melanogaster, mouse to human (Fig. 3). |
T2207 |
5019-5022 |
DT |
denotes |
The |
T2209 |
5023-5026 |
NN |
denotes |
ACD |
T2208 |
5027-5033 |
NN |
denotes |
domain |
T2211 |
5034-5036 |
VBZ |
denotes |
is |
T2212 |
5037-5051 |
RB |
denotes |
evolutionarily |
T2210 |
5052-5061 |
VBN |
denotes |
conserved |
T2213 |
5062-5064 |
IN |
denotes |
in |
T2214 |
5065-5074 |
JJ |
denotes |
divergent |
T2215 |
5075-5082 |
NNS |
denotes |
species |
T2216 |
5083-5090 |
VBG |
denotes |
ranging |
T2217 |
5091-5095 |
IN |
denotes |
from |
T2218 |
5096-5104 |
NNS |
denotes |
bacteria |
T2219 |
5104-5106 |
, |
denotes |
, |
T2220 |
5106-5111 |
NN |
denotes |
yeast |
T2221 |
5111-5113 |
, |
denotes |
, |
T2222 |
5113-5115 |
NNP |
denotes |
C. |
T2223 |
5116-5123 |
NNP |
denotes |
elegans |
T2224 |
5123-5125 |
, |
denotes |
, |
T2225 |
5125-5127 |
NNP |
denotes |
D. |
T2226 |
5128-5140 |
NNP |
denotes |
melanogaster |
T2227 |
5140-5142 |
, |
denotes |
, |
T2228 |
5142-5147 |
NN |
denotes |
mouse |
T2229 |
5148-5150 |
IN |
denotes |
to |
T2230 |
5151-5156 |
JJ |
denotes |
human |
T2231 |
5157-5158 |
-LRB- |
denotes |
( |
T2232 |
5158-5162 |
NN |
denotes |
Fig. |
T2233 |
5163-5164 |
CD |
denotes |
3 |
T2234 |
5164-5165 |
-RRB- |
denotes |
) |
T2235 |
5165-5166 |
. |
denotes |
. |
T2236 |
5166-5361 |
sentence |
denotes |
Particularly, as shown in Fig. 3, Acdp proteins showed very strong AA homology to bacteria CorC protein (35% AA identity with 55% homology), which is involved in magnesium and cobalt efflux [7]. |
T2237 |
5167-5179 |
RB |
denotes |
Particularly |
T2239 |
5179-5181 |
, |
denotes |
, |
T2240 |
5181-5183 |
IN |
denotes |
as |
T2241 |
5184-5189 |
VBN |
denotes |
shown |
T2242 |
5190-5192 |
IN |
denotes |
in |
T2243 |
5193-5197 |
NN |
denotes |
Fig. |
T2244 |
5198-5199 |
CD |
denotes |
3 |
T2245 |
5199-5201 |
, |
denotes |
, |
T2246 |
5201-5205 |
NN |
denotes |
Acdp |
T2247 |
5206-5214 |
NN |
denotes |
proteins |
T2238 |
5215-5221 |
VBD |
denotes |
showed |
T2248 |
5222-5226 |
RB |
denotes |
very |
T2249 |
5227-5233 |
JJ |
denotes |
strong |
T2251 |
5234-5236 |
NN |
denotes |
AA |
T2250 |
5237-5245 |
NN |
denotes |
homology |
T2252 |
5246-5248 |
IN |
denotes |
to |
T2253 |
5249-5257 |
NNS |
denotes |
bacteria |
T2255 |
5258-5262 |
NN |
denotes |
CorC |
T2254 |
5263-5270 |
NN |
denotes |
protein |
T2256 |
5271-5272 |
-LRB- |
denotes |
( |
T2258 |
5272-5274 |
CD |
denotes |
35 |
T2259 |
5274-5275 |
NN |
denotes |
% |
T2260 |
5276-5278 |
NN |
denotes |
AA |
T2257 |
5279-5287 |
NN |
denotes |
identity |
T2261 |
5288-5292 |
IN |
denotes |
with |
T2262 |
5293-5295 |
CD |
denotes |
55 |
T2263 |
5295-5296 |
NN |
denotes |
% |
T2264 |
5297-5305 |
NN |
denotes |
homology |
T2265 |
5305-5306 |
-RRB- |
denotes |
) |
T2266 |
5306-5308 |
, |
denotes |
, |
T2267 |
5308-5313 |
WDT |
denotes |
which |
T2269 |
5314-5316 |
VBZ |
denotes |
is |
T2268 |
5317-5325 |
VBN |
denotes |
involved |
T2270 |
5326-5328 |
IN |
denotes |
in |
T2271 |
5329-5338 |
NN |
denotes |
magnesium |
T2273 |
5339-5342 |
CC |
denotes |
and |
T2274 |
5343-5349 |
NN |
denotes |
cobalt |
T2272 |
5350-5356 |
NN |
denotes |
efflux |
T2275 |
5357-5358 |
-LRB- |
denotes |
[ |
T2276 |
5358-5359 |
CD |
denotes |
7 |
T2277 |
5359-5360 |
-RRB- |
denotes |
] |
T2278 |
5360-5361 |
. |
denotes |
. |
T2279 |
5361-5487 |
sentence |
denotes |
High AA homology was also observed between the Acdp proteins and the yeast Amip3 protein (35% AA identity with 56% homology). |
T2280 |
5362-5366 |
JJ |
denotes |
High |
T2282 |
5367-5369 |
NN |
denotes |
AA |
T2281 |
5370-5378 |
NN |
denotes |
homology |
T2284 |
5379-5382 |
VBD |
denotes |
was |
T2285 |
5383-5387 |
RB |
denotes |
also |
T2283 |
5388-5396 |
VBN |
denotes |
observed |
T2286 |
5397-5404 |
IN |
denotes |
between |
T2287 |
5405-5408 |
DT |
denotes |
the |
T2289 |
5409-5413 |
NN |
denotes |
Acdp |
T2288 |
5414-5422 |
NN |
denotes |
proteins |
T2290 |
5423-5426 |
CC |
denotes |
and |
T2291 |
5427-5430 |
DT |
denotes |
the |
T2293 |
5431-5436 |
NN |
denotes |
yeast |
T2294 |
5437-5442 |
NN |
denotes |
Amip3 |
T2292 |
5443-5450 |
NN |
denotes |
protein |
T2295 |
5451-5452 |
-LRB- |
denotes |
( |
T2297 |
5452-5454 |
CD |
denotes |
35 |
T2298 |
5454-5455 |
NN |
denotes |
% |
T2299 |
5456-5458 |
NN |
denotes |
AA |
T2296 |
5459-5467 |
NN |
denotes |
identity |
T2300 |
5468-5472 |
IN |
denotes |
with |
T2301 |
5473-5475 |
CD |
denotes |
56 |
T2303 |
5475-5476 |
NN |
denotes |
% |
T2302 |
5477-5485 |
NN |
denotes |
homology |
T2304 |
5485-5486 |
-RRB- |
denotes |
) |
T2305 |
5486-5487 |
. |
denotes |
. |
T2306 |
5487-5556 |
sentence |
denotes |
The Amip3 is likely to be a homologous to the bacteria CorC protein. |
T2307 |
5488-5491 |
DT |
denotes |
The |
T2308 |
5492-5497 |
NN |
denotes |
Amip3 |
T2309 |
5498-5500 |
VBZ |
denotes |
is |
T2310 |
5501-5507 |
JJ |
denotes |
likely |
T2311 |
5508-5510 |
TO |
denotes |
to |
T2312 |
5511-5513 |
VB |
denotes |
be |
T2313 |
5514-5515 |
DT |
denotes |
a |
T2314 |
5516-5526 |
JJ |
denotes |
homologous |
T2315 |
5527-5529 |
IN |
denotes |
to |
T2316 |
5530-5533 |
DT |
denotes |
the |
T2318 |
5534-5542 |
NNS |
denotes |
bacteria |
T2319 |
5543-5547 |
NN |
denotes |
CorC |
T2317 |
5548-5555 |
NN |
denotes |
protein |
T2320 |
5555-5556 |
. |
denotes |
. |
T2321 |
5556-5708 |
sentence |
denotes |
The Amip3 mutants confer resistance to copper toxicity (Personal communication with Dr. V.C. Culotte, John Hopkins Bloomberg, School of Public Health). |
T2322 |
5557-5560 |
DT |
denotes |
The |
T2324 |
5561-5566 |
NN |
denotes |
Amip3 |
T2323 |
5567-5574 |
NNS |
denotes |
mutants |
T2325 |
5575-5581 |
VBP |
denotes |
confer |
T2326 |
5582-5592 |
NN |
denotes |
resistance |
T2327 |
5593-5595 |
IN |
denotes |
to |
T2328 |
5596-5602 |
NN |
denotes |
copper |
T2329 |
5603-5611 |
NN |
denotes |
toxicity |
T2330 |
5612-5613 |
-LRB- |
denotes |
( |
T2332 |
5613-5621 |
JJ |
denotes |
Personal |
T2333 |
5622-5635 |
NN |
denotes |
communication |
T2334 |
5636-5640 |
IN |
denotes |
with |
T2331 |
5641-5644 |
NNP |
denotes |
Dr. |
T2335 |
5645-5649 |
NNP |
denotes |
V.C. |
T2336 |
5650-5657 |
NNP |
denotes |
Culotte |
T2337 |
5657-5659 |
, |
denotes |
, |
T2338 |
5659-5663 |
NNP |
denotes |
John |
T2339 |
5664-5671 |
NNP |
denotes |
Hopkins |
T2340 |
5672-5681 |
NNP |
denotes |
Bloomberg |
T2341 |
5681-5683 |
, |
denotes |
, |
T2342 |
5683-5689 |
NNP |
denotes |
School |
T2343 |
5690-5692 |
IN |
denotes |
of |
T2344 |
5693-5699 |
NNP |
denotes |
Public |
T2345 |
5700-5706 |
NNP |
denotes |
Health |
T2346 |
5706-5707 |
-RRB- |
denotes |
) |
T2347 |
5707-5708 |
. |
denotes |
. |
T2348 |
5708-5858 |
sentence |
denotes |
The evolutionary relationships among those proteins are illustrated by a phylogenetic tree constructed based on the AA homology of proteins (Fig. 4). |
T2349 |
5709-5712 |
DT |
denotes |
The |
T2351 |
5713-5725 |
JJ |
denotes |
evolutionary |
T2350 |
5726-5739 |
NNS |
denotes |
relationships |
T2353 |
5740-5745 |
IN |
denotes |
among |
T2354 |
5746-5751 |
DT |
denotes |
those |
T2355 |
5752-5760 |
NN |
denotes |
proteins |
T2356 |
5761-5764 |
VBP |
denotes |
are |
T2352 |
5765-5776 |
VBN |
denotes |
illustrated |
T2357 |
5777-5779 |
IN |
denotes |
by |
T2358 |
5780-5781 |
DT |
denotes |
a |
T2360 |
5782-5794 |
JJ |
denotes |
phylogenetic |
T2359 |
5795-5799 |
NN |
denotes |
tree |
T2361 |
5800-5811 |
VBN |
denotes |
constructed |
T2362 |
5812-5817 |
VBN |
denotes |
based |
T2363 |
5818-5820 |
IN |
denotes |
on |
T2364 |
5821-5824 |
DT |
denotes |
the |
T2366 |
5825-5827 |
NN |
denotes |
AA |
T2365 |
5828-5836 |
NN |
denotes |
homology |
T2367 |
5837-5839 |
IN |
denotes |
of |
T2368 |
5840-5848 |
NN |
denotes |
proteins |
T2369 |
5849-5850 |
-LRB- |
denotes |
( |
T2370 |
5850-5854 |
NN |
denotes |
Fig. |
T2371 |
5855-5856 |
CD |
denotes |
4 |
T2372 |
5856-5857 |
-RRB- |
denotes |
) |
T2373 |
5857-5858 |
. |
denotes |
. |
T2374 |
5858-5859 |
sentence |
denotes |
|
T6623 |
5868-5878 |
NN |
denotes |
Nucleotide |
T6625 |
5879-5882 |
CC |
denotes |
and |
T6626 |
5883-5888 |
NN |
denotes |
amino |
T6627 |
5889-5893 |
NN |
denotes |
acid |
T6624 |
5894-5904 |
NNS |
denotes |
homologies |
T6628 |
5905-5906 |
-LRB- |
denotes |
( |
T6629 |
5906-5907 |
NN |
denotes |
% |
T6630 |
5907-5908 |
-RRB- |
denotes |
) |
T6631 |
5909-5916 |
IN |
denotes |
between |
T6632 |
5917-5922 |
JJ |
denotes |
human |
T6633 |
5923-5927 |
NN |
denotes |
ACDP |
T6635 |
5928-5931 |
CC |
denotes |
and |
T6636 |
5932-5937 |
NN |
denotes |
mouse |
T6637 |
5938-5942 |
NN |
denotes |
Acdp |
T6634 |
5943-5950 |
NNS |
denotes |
members |
T6638 |
5950-5951 |
. |
denotes |
. |
T5826 |
6138-6143 |
NN |
denotes |
Amino |
T5827 |
6144-6148 |
NN |
denotes |
acid |
T5828 |
6149-6157 |
NN |
denotes |
sequence |
T5830 |
6158-6166 |
NN |
denotes |
homology |
T5829 |
6167-6176 |
NN |
denotes |
alignment |
T5831 |
6177-6180 |
IN |
denotes |
for |
T5832 |
6181-6184 |
DT |
denotes |
all |
T5833 |
6185-6187 |
IN |
denotes |
of |
T5834 |
6188-6191 |
DT |
denotes |
the |
T5836 |
6192-6196 |
NN |
denotes |
ACDP |
T5837 |
6197-6200 |
CC |
denotes |
and |
T5838 |
6201-6205 |
NN |
denotes |
Acdp |
T5835 |
6206-6211 |
NNS |
denotes |
genes |
T5839 |
6212-6218 |
IN |
denotes |
within |
T5840 |
6219-6222 |
DT |
denotes |
the |
T5842 |
6223-6226 |
NN |
denotes |
ACD |
T5841 |
6227-6233 |
NN |
denotes |
domain |
T5843 |
6233-6234 |
. |
denotes |
. |
T5844 |
6234-6400 |
sentence |
denotes |
The sequence data for the Acdp genes have been deposited in GenBank under accession number AF202994 (Acdp1), AF216961 (Acdp2), AF216964 (Acdp3) and AF216963 (Acdp4). |
T5845 |
6235-6238 |
DT |
denotes |
The |
T5847 |
6239-6247 |
NN |
denotes |
sequence |
T5846 |
6248-6252 |
NNS |
denotes |
data |
T5849 |
6253-6256 |
IN |
denotes |
for |
T5850 |
6257-6260 |
DT |
denotes |
the |
T5852 |
6261-6265 |
NN |
denotes |
Acdp |
T5851 |
6266-6271 |
NNS |
denotes |
genes |
T5853 |
6272-6276 |
VBP |
denotes |
have |
T5854 |
6277-6281 |
VBN |
denotes |
been |
T5848 |
6282-6291 |
VBN |
denotes |
deposited |
T5855 |
6292-6294 |
IN |
denotes |
in |
T5856 |
6295-6302 |
NNP |
denotes |
GenBank |
T5857 |
6303-6308 |
IN |
denotes |
under |
T5858 |
6309-6318 |
NN |
denotes |
accession |
T5860 |
6319-6325 |
NN |
denotes |
number |
T5859 |
6326-6334 |
NN |
denotes |
AF202994 |
T5861 |
6335-6336 |
-LRB- |
denotes |
( |
T5862 |
6336-6341 |
NN |
denotes |
Acdp1 |
T5863 |
6341-6342 |
-RRB- |
denotes |
) |
T5864 |
6342-6344 |
, |
denotes |
, |
T5865 |
6344-6352 |
NN |
denotes |
AF216961 |
T5866 |
6353-6354 |
-LRB- |
denotes |
( |
T5867 |
6354-6359 |
NN |
denotes |
Acdp2 |
T5868 |
6359-6360 |
-RRB- |
denotes |
) |
T5869 |
6360-6362 |
, |
denotes |
, |
T5870 |
6362-6370 |
NN |
denotes |
AF216964 |
T5871 |
6371-6372 |
-LRB- |
denotes |
( |
T5872 |
6372-6377 |
NN |
denotes |
Acdp3 |
T5873 |
6377-6378 |
-RRB- |
denotes |
) |
T5874 |
6379-6382 |
CC |
denotes |
and |
T5875 |
6383-6391 |
NN |
denotes |
AF216963 |
T5876 |
6392-6393 |
-LRB- |
denotes |
( |
T5877 |
6393-6398 |
NN |
denotes |
Acdp4 |
T5878 |
6398-6399 |
-RRB- |
denotes |
) |
T5879 |
6399-6400 |
. |
denotes |
. |
T5880 |
6400-6503 |
sentence |
denotes |
Identical amino acids or amino acids with very strong homologies among all proteins were shaded black. |
T5881 |
6401-6410 |
JJ |
denotes |
Identical |
T5883 |
6411-6416 |
NN |
denotes |
amino |
T5882 |
6417-6422 |
NNS |
denotes |
acids |
T5885 |
6423-6425 |
CC |
denotes |
or |
T5886 |
6426-6431 |
NN |
denotes |
amino |
T5887 |
6432-6437 |
NNS |
denotes |
acids |
T5888 |
6438-6442 |
IN |
denotes |
with |
T5889 |
6443-6447 |
RB |
denotes |
very |
T5890 |
6448-6454 |
JJ |
denotes |
strong |
T5891 |
6455-6465 |
NNS |
denotes |
homologies |
T5892 |
6466-6471 |
IN |
denotes |
among |
T5893 |
6472-6475 |
DT |
denotes |
all |
T5894 |
6476-6484 |
NN |
denotes |
proteins |
T5895 |
6485-6489 |
VBD |
denotes |
were |
T5884 |
6490-6496 |
VBN |
denotes |
shaded |
T5896 |
6497-6502 |
JJ |
denotes |
black |
T5897 |
6502-6503 |
. |
denotes |
. |
T5898 |
6503-6610 |
sentence |
denotes |
Identical amino acids or amino acids with very strong homologies in most of the proteins were shaded grey. |
T5899 |
6504-6513 |
JJ |
denotes |
Identical |
T5901 |
6514-6519 |
NN |
denotes |
amino |
T5900 |
6520-6525 |
NNS |
denotes |
acids |
T5903 |
6526-6528 |
CC |
denotes |
or |
T5904 |
6529-6534 |
NN |
denotes |
amino |
T5905 |
6535-6540 |
NNS |
denotes |
acids |
T5906 |
6541-6545 |
IN |
denotes |
with |
T5907 |
6546-6550 |
RB |
denotes |
very |
T5908 |
6551-6557 |
JJ |
denotes |
strong |
T5909 |
6558-6568 |
NNS |
denotes |
homologies |
T5910 |
6569-6571 |
IN |
denotes |
in |
T5911 |
6572-6576 |
JJS |
denotes |
most |
T5912 |
6577-6579 |
IN |
denotes |
of |
T5913 |
6580-6583 |
DT |
denotes |
the |
T5914 |
6584-6592 |
NN |
denotes |
proteins |
T5915 |
6593-6597 |
VBD |
denotes |
were |
T5902 |
6598-6604 |
VBN |
denotes |
shaded |
T5916 |
6605-6609 |
JJ |
denotes |
grey |
T5917 |
6609-6610 |
. |
denotes |
. |
T5918 |
6610-6654 |
sentence |
denotes |
Dot lines represent gaps for the alignment. |
T5919 |
6611-6614 |
NN |
denotes |
Dot |
T5920 |
6615-6620 |
NNS |
denotes |
lines |
T5921 |
6621-6630 |
VBP |
denotes |
represent |
T5922 |
6631-6635 |
NNS |
denotes |
gaps |
T5923 |
6636-6639 |
IN |
denotes |
for |
T5924 |
6640-6643 |
DT |
denotes |
the |
T5925 |
6644-6653 |
NN |
denotes |
alignment |
T5926 |
6653-6654 |
. |
denotes |
. |
T6010 |
6665-6670 |
NN |
denotes |
Amino |
T6011 |
6671-6675 |
NN |
denotes |
acid |
T6013 |
6676-6684 |
NN |
denotes |
sequence |
T6012 |
6685-6694 |
NN |
denotes |
alignment |
T6014 |
6695-6702 |
VBG |
denotes |
showing |
T6015 |
6703-6706 |
DT |
denotes |
the |
T6016 |
6707-6719 |
NN |
denotes |
conservation |
T6017 |
6720-6722 |
IN |
denotes |
of |
T6018 |
6723-6726 |
NN |
denotes |
ACD |
T6019 |
6727-6733 |
NN |
denotes |
domain |
T6020 |
6734-6736 |
IN |
denotes |
in |
T6021 |
6737-6744 |
JJ |
denotes |
various |
T6022 |
6745-6752 |
NNS |
denotes |
species |
T6023 |
6752-6753 |
. |
denotes |
. |
T6024 |
6753-6815 |
sentence |
denotes |
Amip3 is a protein from Saccharomyces cerevisiae (NP_014581). |
T6025 |
6754-6759 |
NN |
denotes |
Amip3 |
T6026 |
6760-6762 |
VBZ |
denotes |
is |
T6027 |
6763-6764 |
DT |
denotes |
a |
T6028 |
6765-6772 |
NN |
denotes |
protein |
T6029 |
6773-6777 |
IN |
denotes |
from |
T6030 |
6778-6791 |
NNP |
denotes |
Saccharomyces |
T6031 |
6792-6802 |
NNP |
denotes |
cerevisiae |
T6032 |
6803-6804 |
-LRB- |
denotes |
( |
T6033 |
6804-6813 |
NN |
denotes |
NP_014581 |
T6034 |
6813-6814 |
-RRB- |
denotes |
) |
T6035 |
6814-6815 |
. |
denotes |
. |
T6036 |
6815-6867 |
sentence |
denotes |
CanG is a protein from Candida glabrata (AAF33142). |
T6037 |
6816-6820 |
NN |
denotes |
CanG |
T6038 |
6821-6823 |
VBZ |
denotes |
is |
T6039 |
6824-6825 |
DT |
denotes |
a |
T6040 |
6826-6833 |
NN |
denotes |
protein |
T6041 |
6834-6838 |
IN |
denotes |
from |
T6042 |
6839-6846 |
NNP |
denotes |
Candida |
T6043 |
6847-6855 |
NNP |
denotes |
glabrata |
T6044 |
6856-6857 |
-LRB- |
denotes |
( |
T6045 |
6857-6865 |
NN |
denotes |
AAF33142 |
T6046 |
6865-6866 |
-RRB- |
denotes |
) |
T6047 |
6866-6867 |
. |
denotes |
. |
T6048 |
6867-6933 |
sentence |
denotes |
NeuC (EAA31204) is a hypothetical protein from Neurospora crassa. |
T6049 |
6868-6872 |
NN |
denotes |
NeuC |
T6051 |
6873-6874 |
-LRB- |
denotes |
( |
T6052 |
6874-6882 |
NN |
denotes |
EAA31204 |
T6053 |
6882-6883 |
-RRB- |
denotes |
) |
T6050 |
6884-6886 |
VBZ |
denotes |
is |
T6054 |
6887-6888 |
DT |
denotes |
a |
T6056 |
6889-6901 |
JJ |
denotes |
hypothetical |
T6055 |
6902-6909 |
NN |
denotes |
protein |
T6057 |
6910-6914 |
IN |
denotes |
from |
T6058 |
6915-6925 |
NNP |
denotes |
Neurospora |
T6059 |
6926-6932 |
NNP |
denotes |
crassa |
T6060 |
6932-6933 |
. |
denotes |
. |
T6061 |
6933-6978 |
sentence |
denotes |
DroM is a gene product from D. melanogaster. |
T6062 |
6934-6938 |
NN |
denotes |
DroM |
T6063 |
6939-6941 |
VBZ |
denotes |
is |
T6064 |
6942-6943 |
DT |
denotes |
a |
T6066 |
6944-6948 |
NN |
denotes |
gene |
T6065 |
6949-6956 |
NN |
denotes |
product |
T6067 |
6957-6961 |
IN |
denotes |
from |
T6068 |
6962-6964 |
NNP |
denotes |
D. |
T6069 |
6965-6977 |
NNP |
denotes |
melanogaster |
T6070 |
6977-6978 |
. |
denotes |
. |
T6071 |
6978-7070 |
sentence |
denotes |
The accession number for this gene is CG40084 in BDGP (Berkeley Drosophila Genome Project). |
T6072 |
6979-6982 |
DT |
denotes |
The |
T6074 |
6983-6992 |
NN |
denotes |
accession |
T6073 |
6993-6999 |
NN |
denotes |
number |
T6076 |
7000-7003 |
IN |
denotes |
for |
T6077 |
7004-7008 |
DT |
denotes |
this |
T6078 |
7009-7013 |
NN |
denotes |
gene |
T6075 |
7014-7016 |
VBZ |
denotes |
is |
T6079 |
7017-7024 |
NN |
denotes |
CG40084 |
T6080 |
7025-7027 |
IN |
denotes |
in |
T6081 |
7028-7032 |
NN |
denotes |
BDGP |
T6082 |
7033-7034 |
-LRB- |
denotes |
( |
T6083 |
7034-7042 |
NNP |
denotes |
Berkeley |
T6085 |
7043-7053 |
NNP |
denotes |
Drosophila |
T6086 |
7054-7060 |
NNP |
denotes |
Genome |
T6084 |
7061-7068 |
NNP |
denotes |
Project |
T6087 |
7068-7069 |
-RRB- |
denotes |
) |
T6088 |
7069-7070 |
. |
denotes |
. |
T6089 |
7070-7140 |
sentence |
denotes |
AnoG represents a protein from the anopheles gambiae str. (EAA01004). |
T6090 |
7071-7075 |
NN |
denotes |
AnoG |
T6091 |
7076-7086 |
VBZ |
denotes |
represents |
T6092 |
7087-7088 |
DT |
denotes |
a |
T6093 |
7089-7096 |
NN |
denotes |
protein |
T6094 |
7097-7101 |
IN |
denotes |
from |
T6095 |
7102-7105 |
DT |
denotes |
the |
T6097 |
7106-7115 |
NNP |
denotes |
anopheles |
T6098 |
7116-7123 |
NNP |
denotes |
gambiae |
T6096 |
7124-7128 |
NN |
denotes |
str. |
T6099 |
7129-7130 |
-LRB- |
denotes |
( |
T6100 |
7130-7138 |
NN |
denotes |
EAA01004 |
T6101 |
7138-7139 |
-RRB- |
denotes |
) |
T6102 |
7139-7140 |
. |
denotes |
. |
T6103 |
7140-7214 |
sentence |
denotes |
CaeE (AAK77203) is a hypothetical protein from the Caenohabditis elegans. |
T6104 |
7141-7145 |
NN |
denotes |
CaeE |
T6106 |
7146-7147 |
-LRB- |
denotes |
( |
T6107 |
7147-7155 |
NN |
denotes |
AAK77203 |
T6108 |
7155-7156 |
-RRB- |
denotes |
) |
T6105 |
7157-7159 |
VBZ |
denotes |
is |
T6109 |
7160-7161 |
DT |
denotes |
a |
T6111 |
7162-7174 |
JJ |
denotes |
hypothetical |
T6110 |
7175-7182 |
NN |
denotes |
protein |
T6112 |
7183-7187 |
IN |
denotes |
from |
T6113 |
7188-7191 |
DT |
denotes |
the |
T6115 |
7192-7205 |
NNP |
denotes |
Caenohabditis |
T6114 |
7206-7213 |
NNP |
denotes |
elegans |
T6116 |
7213-7214 |
. |
denotes |
. |
T6117 |
7214-7307 |
sentence |
denotes |
CorC represents bacteria magnesium and cobalt efflux protein from the Shewanella oneidensis. |
T6118 |
7215-7219 |
NN |
denotes |
CorC |
T6119 |
7220-7230 |
VBZ |
denotes |
represents |
T6120 |
7231-7239 |
NNS |
denotes |
bacteria |
T6121 |
7240-7249 |
NN |
denotes |
magnesium |
T6122 |
7250-7253 |
CC |
denotes |
and |
T6123 |
7254-7260 |
NN |
denotes |
cobalt |
T6125 |
7261-7267 |
NN |
denotes |
efflux |
T6124 |
7268-7275 |
NN |
denotes |
protein |
T6126 |
7276-7280 |
IN |
denotes |
from |
T6127 |
7281-7284 |
DT |
denotes |
the |
T6129 |
7285-7295 |
NNP |
denotes |
Shewanella |
T6128 |
7296-7306 |
NNP |
denotes |
oneidensis |
T6130 |
7306-7307 |
. |
denotes |
. |
T6131 |
7307-7387 |
sentence |
denotes |
XyFD is a hypothetical protein from the Xylella fastidiosa Dixon (ZP_00038107). |
T6132 |
7308-7312 |
NN |
denotes |
XyFD |
T6133 |
7313-7315 |
VBZ |
denotes |
is |
T6134 |
7316-7317 |
DT |
denotes |
a |
T6136 |
7318-7330 |
JJ |
denotes |
hypothetical |
T6135 |
7331-7338 |
NN |
denotes |
protein |
T6137 |
7339-7343 |
IN |
denotes |
from |
T6138 |
7344-7347 |
DT |
denotes |
the |
T6140 |
7348-7355 |
NNP |
denotes |
Xylella |
T6141 |
7356-7366 |
NNP |
denotes |
fastidiosa |
T6139 |
7367-7372 |
NNP |
denotes |
Dixon |
T6142 |
7373-7374 |
-LRB- |
denotes |
( |
T6143 |
7374-7385 |
NN |
denotes |
ZP_00038107 |
T6144 |
7385-7386 |
-RRB- |
denotes |
) |
T6145 |
7386-7387 |
. |
denotes |
. |
T6153 |
7398-7410 |
JJ |
denotes |
Phylogenetic |
T6154 |
7411-7415 |
NN |
denotes |
tree |
T6155 |
7416-7423 |
VBG |
denotes |
showing |
T6156 |
7424-7437 |
NNS |
denotes |
relationships |
T6157 |
7438-7443 |
IN |
denotes |
among |
T6158 |
7444-7452 |
NN |
denotes |
proteins |
T6159 |
7453-7463 |
VBG |
denotes |
containing |
T6160 |
7464-7467 |
DT |
denotes |
the |
T6162 |
7468-7471 |
NN |
denotes |
ACD |
T6161 |
7472-7478 |
NN |
denotes |
domain |
T6163 |
7479-7483 |
IN |
denotes |
from |
T6164 |
7484-7490 |
NN |
denotes |
figure |
T6165 |
7491-7492 |
CD |
denotes |
2 |
T6166 |
7493-7496 |
CC |
denotes |
and |
T6167 |
7497-7498 |
CD |
denotes |
3 |
T6168 |
7498-7499 |
. |
denotes |
. |
T6169 |
7499-7612 |
sentence |
denotes |
The phylogenetic tree was constructed according to the calculation of the best match for the selected sequences. |
T6170 |
7500-7503 |
DT |
denotes |
The |
T6172 |
7504-7516 |
JJ |
denotes |
phylogenetic |
T6171 |
7517-7521 |
NN |
denotes |
tree |
T6174 |
7522-7525 |
VBD |
denotes |
was |
T6173 |
7526-7537 |
VBN |
denotes |
constructed |
T6175 |
7538-7547 |
VBG |
denotes |
according |
T6176 |
7548-7550 |
IN |
denotes |
to |
T6177 |
7551-7554 |
DT |
denotes |
the |
T6178 |
7555-7566 |
NN |
denotes |
calculation |
T6179 |
7567-7569 |
IN |
denotes |
of |
T6180 |
7570-7573 |
DT |
denotes |
the |
T6182 |
7574-7578 |
JJS |
denotes |
best |
T6181 |
7579-7584 |
NN |
denotes |
match |
T6183 |
7585-7588 |
IN |
denotes |
for |
T6184 |
7589-7592 |
DT |
denotes |
the |
T6186 |
7593-7601 |
JJ |
denotes |
selected |
T6185 |
7602-7611 |
NNS |
denotes |
sequences |
T6187 |
7611-7612 |
. |
denotes |
. |
T6188 |
7612-7682 |
sentence |
denotes |
Abbreviations for each protein are the same as presented in figure 3. |
T6189 |
7613-7626 |
NNS |
denotes |
Abbreviations |
T6191 |
7627-7630 |
IN |
denotes |
for |
T6192 |
7631-7635 |
DT |
denotes |
each |
T6193 |
7636-7643 |
NN |
denotes |
protein |
T6190 |
7644-7647 |
VBP |
denotes |
are |
T6194 |
7648-7651 |
DT |
denotes |
the |
T6195 |
7652-7656 |
JJ |
denotes |
same |
T6196 |
7657-7659 |
IN |
denotes |
as |
T6197 |
7660-7669 |
VBN |
denotes |
presented |
T6198 |
7670-7672 |
IN |
denotes |
in |
T6199 |
7673-7679 |
NN |
denotes |
figure |
T6200 |
7680-7681 |
CD |
denotes |
3 |
T6201 |
7681-7682 |
. |
denotes |
. |
T2376 |
7683-7685 |
PRP |
denotes |
We |
T2375 |
7683-7866 |
sentence |
denotes |
We found that all mouse Acdp members contain four distinct transmembrane domains (Fig. 5), two CBS domains and a DUF21 domain that are found in bacteria CorC and yeast Amip3 proteins. |
T2377 |
7686-7691 |
VBD |
denotes |
found |
T2378 |
7692-7696 |
IN |
denotes |
that |
T2380 |
7697-7700 |
DT |
denotes |
all |
T2382 |
7701-7706 |
NN |
denotes |
mouse |
T2383 |
7707-7711 |
NN |
denotes |
Acdp |
T2381 |
7712-7719 |
NNS |
denotes |
members |
T2379 |
7720-7727 |
VBP |
denotes |
contain |
T2384 |
7728-7732 |
CD |
denotes |
four |
T2386 |
7733-7741 |
JJ |
denotes |
distinct |
T2387 |
7742-7755 |
NN |
denotes |
transmembrane |
T2385 |
7756-7763 |
NNS |
denotes |
domains |
T2388 |
7764-7765 |
-LRB- |
denotes |
( |
T2389 |
7765-7769 |
NN |
denotes |
Fig. |
T2390 |
7770-7771 |
CD |
denotes |
5 |
T2391 |
7771-7772 |
-RRB- |
denotes |
) |
T2392 |
7772-7774 |
, |
denotes |
, |
T2393 |
7774-7777 |
CD |
denotes |
two |
T2395 |
7778-7781 |
NN |
denotes |
CBS |
T2394 |
7782-7789 |
NNS |
denotes |
domains |
T2396 |
7790-7793 |
CC |
denotes |
and |
T2397 |
7794-7795 |
DT |
denotes |
a |
T2399 |
7796-7801 |
NN |
denotes |
DUF21 |
T2398 |
7802-7808 |
NN |
denotes |
domain |
T2400 |
7809-7813 |
WDT |
denotes |
that |
T2402 |
7814-7817 |
VBP |
denotes |
are |
T2401 |
7818-7823 |
VBN |
denotes |
found |
T2403 |
7824-7826 |
IN |
denotes |
in |
T2404 |
7827-7835 |
NNS |
denotes |
bacteria |
T2405 |
7836-7840 |
NN |
denotes |
CorC |
T2407 |
7841-7844 |
CC |
denotes |
and |
T2408 |
7845-7850 |
NN |
denotes |
yeast |
T2409 |
7851-7856 |
NN |
denotes |
Amip3 |
T2406 |
7857-7865 |
NN |
denotes |
proteins |
T2410 |
7865-7866 |
. |
denotes |
. |
T2411 |
7866-7970 |
sentence |
denotes |
CBS domains are small intracellular modules that are mostly found in 2 or four copies within a protein. |
T2412 |
7867-7870 |
NN |
denotes |
CBS |
T2413 |
7871-7878 |
NNS |
denotes |
domains |
T2414 |
7879-7882 |
VBP |
denotes |
are |
T2415 |
7883-7888 |
JJ |
denotes |
small |
T2417 |
7889-7902 |
JJ |
denotes |
intracellular |
T2416 |
7903-7910 |
NNS |
denotes |
modules |
T2418 |
7911-7915 |
WDT |
denotes |
that |
T2420 |
7916-7919 |
VBP |
denotes |
are |
T2421 |
7920-7926 |
RB |
denotes |
mostly |
T2419 |
7927-7932 |
VBN |
denotes |
found |
T2422 |
7933-7935 |
IN |
denotes |
in |
T2423 |
7936-7937 |
CD |
denotes |
2 |
T2425 |
7938-7940 |
CC |
denotes |
or |
T2426 |
7941-7945 |
CD |
denotes |
four |
T2424 |
7946-7952 |
NNS |
denotes |
copies |
T2427 |
7953-7959 |
IN |
denotes |
within |
T2428 |
7960-7961 |
DT |
denotes |
a |
T2429 |
7962-7969 |
NN |
denotes |
protein |
T2430 |
7969-7970 |
. |
denotes |
. |
T2431 |
7970-8038 |
sentence |
denotes |
Pairs of CBS domains dimerise to form a stable globular domain [8]. |
T2432 |
7971-7976 |
NNS |
denotes |
Pairs |
T2434 |
7977-7979 |
IN |
denotes |
of |
T2435 |
7980-7983 |
NN |
denotes |
CBS |
T2436 |
7984-7991 |
NNS |
denotes |
domains |
T2433 |
7992-8000 |
VBP |
denotes |
dimerise |
T2437 |
8001-8003 |
TO |
denotes |
to |
T2438 |
8004-8008 |
VB |
denotes |
form |
T2439 |
8009-8010 |
DT |
denotes |
a |
T2441 |
8011-8017 |
JJ |
denotes |
stable |
T2442 |
8018-8026 |
JJ |
denotes |
globular |
T2440 |
8027-8033 |
NN |
denotes |
domain |
T2443 |
8034-8035 |
-LRB- |
denotes |
[ |
T2444 |
8035-8036 |
CD |
denotes |
8 |
T2445 |
8036-8037 |
-RRB- |
denotes |
] |
T2446 |
8037-8038 |
. |
denotes |
. |
T2447 |
8038-8111 |
sentence |
denotes |
DUF21 (CD: pfam01959.9) is a newly defined domain with unknown function. |
T2448 |
8039-8044 |
NN |
denotes |
DUF21 |
T2450 |
8045-8046 |
-LRB- |
denotes |
( |
T2452 |
8046-8048 |
NN |
denotes |
CD |
T2453 |
8048-8050 |
: |
denotes |
: |
T2451 |
8050-8061 |
NN |
denotes |
pfam01959.9 |
T2454 |
8061-8062 |
-RRB- |
denotes |
) |
T2449 |
8063-8065 |
VBZ |
denotes |
is |
T2455 |
8066-8067 |
DT |
denotes |
a |
T2457 |
8068-8073 |
RB |
denotes |
newly |
T2458 |
8074-8081 |
VBN |
denotes |
defined |
T2456 |
8082-8088 |
NN |
denotes |
domain |
T2459 |
8089-8093 |
IN |
denotes |
with |
T2460 |
8094-8101 |
JJ |
denotes |
unknown |
T2461 |
8102-8110 |
NN |
denotes |
function |
T2462 |
8110-8111 |
. |
denotes |
. |
T2463 |
8111-8251 |
sentence |
denotes |
This domain is a transmembrane region and found to be located in the N-terminus of the proteins adjacent to two intracellular CBS domains . |
T2464 |
8112-8116 |
DT |
denotes |
This |
T2465 |
8117-8123 |
NN |
denotes |
domain |
T2466 |
8124-8126 |
VBZ |
denotes |
is |
T2467 |
8127-8128 |
DT |
denotes |
a |
T2469 |
8129-8142 |
JJ |
denotes |
transmembrane |
T2468 |
8143-8149 |
NN |
denotes |
region |
T2470 |
8150-8153 |
CC |
denotes |
and |
T2471 |
8154-8159 |
VBN |
denotes |
found |
T2472 |
8160-8162 |
TO |
denotes |
to |
T2474 |
8163-8165 |
VB |
denotes |
be |
T2473 |
8166-8173 |
VBN |
denotes |
located |
T2475 |
8174-8176 |
IN |
denotes |
in |
T2476 |
8177-8180 |
DT |
denotes |
the |
T2478 |
8181-8182 |
NN |
denotes |
N |
T2479 |
8182-8183 |
HYPH |
denotes |
- |
T2477 |
8183-8191 |
NN |
denotes |
terminus |
T2480 |
8192-8194 |
IN |
denotes |
of |
T2481 |
8195-8198 |
DT |
denotes |
the |
T2482 |
8199-8207 |
NN |
denotes |
proteins |
T2483 |
8208-8216 |
JJ |
denotes |
adjacent |
T2484 |
8217-8219 |
IN |
denotes |
to |
T2485 |
8220-8223 |
CD |
denotes |
two |
T2487 |
8224-8237 |
JJ |
denotes |
intracellular |
T2488 |
8238-8241 |
NN |
denotes |
CBS |
T2486 |
8242-8249 |
NNS |
denotes |
domains |
T2489 |
8250-8251 |
. |
denotes |
. |
T2490 |
8251-8353 |
sentence |
denotes |
A cNMP-binding domain (cyclic nucleotide-monophosphate-binding domain) was found in all Acdp members. |
T2491 |
8252-8253 |
DT |
denotes |
A |
T2493 |
8254-8258 |
NN |
denotes |
cNMP |
T2495 |
8258-8259 |
HYPH |
denotes |
- |
T2494 |
8259-8266 |
VBG |
denotes |
binding |
T2492 |
8267-8273 |
NN |
denotes |
domain |
T2497 |
8274-8275 |
-LRB- |
denotes |
( |
T2499 |
8275-8281 |
JJ |
denotes |
cyclic |
T2501 |
8282-8292 |
NN |
denotes |
nucleotide |
T2502 |
8292-8293 |
HYPH |
denotes |
- |
T2500 |
8293-8306 |
NN |
denotes |
monophosphate |
T2503 |
8306-8307 |
HYPH |
denotes |
- |
T2504 |
8307-8314 |
VBG |
denotes |
binding |
T2498 |
8315-8321 |
NN |
denotes |
domain |
T2505 |
8321-8322 |
-RRB- |
denotes |
) |
T2506 |
8323-8326 |
VBD |
denotes |
was |
T2496 |
8327-8332 |
VBN |
denotes |
found |
T2507 |
8333-8335 |
IN |
denotes |
in |
T2508 |
8336-8339 |
DT |
denotes |
all |
T2510 |
8340-8344 |
NN |
denotes |
Acdp |
T2509 |
8345-8352 |
NNS |
denotes |
members |
T2511 |
8352-8353 |
. |
denotes |
. |
T2512 |
8353-9080 |
sentence |
denotes |
Figure 5 Four transmembrane domains within Acdp4 protein. Transmembrane domains were predicted by the TMHMM program . The plot shows the posterior probabilities of inside /outside/TM helix. At the top of the plot (between 1 and 1.2) the N-best prediction is shown. The plot is obtained by calculating the total probability that a residue sits in helix, inside, or outside summed over all possible paths through the model. In addition, Acdp1 contains an Alanine-rich region (2–10: AAAAAAAAA), a Leucine-rich region (204–257: LLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALF SGLRLSLLSLDPVELRVL), a Proline-rich region (78–130: PGPPVPAAPVPAPSLA PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP), and two amidation sites (917–920: MGKK; 926–929: SGRK). |
T6228 |
8364-8368 |
CD |
denotes |
Four |
T6230 |
8369-8382 |
NN |
denotes |
transmembrane |
T6229 |
8383-8390 |
NNS |
denotes |
domains |
T6231 |
8391-8397 |
IN |
denotes |
within |
T6232 |
8398-8403 |
NN |
denotes |
Acdp4 |
T6233 |
8404-8411 |
NN |
denotes |
protein |
T6234 |
8411-8412 |
. |
denotes |
. |
T6235 |
8412-8472 |
sentence |
denotes |
Transmembrane domains were predicted by the TMHMM program . |
T6236 |
8413-8426 |
NN |
denotes |
Transmembrane |
T6237 |
8427-8434 |
NNS |
denotes |
domains |
T6239 |
8435-8439 |
VBD |
denotes |
were |
T6238 |
8440-8449 |
VBN |
denotes |
predicted |
T6240 |
8450-8452 |
IN |
denotes |
by |
T6241 |
8453-8456 |
DT |
denotes |
the |
T6243 |
8457-8462 |
NN |
denotes |
TMHMM |
T6242 |
8463-8470 |
NN |
denotes |
program |
T6244 |
8471-8472 |
. |
denotes |
. |
T6245 |
8472-8544 |
sentence |
denotes |
The plot shows the posterior probabilities of inside /outside/TM helix. |
T6246 |
8473-8476 |
DT |
denotes |
The |
T6247 |
8477-8481 |
NN |
denotes |
plot |
T6248 |
8482-8487 |
VBZ |
denotes |
shows |
T6249 |
8488-8491 |
DT |
denotes |
the |
T6251 |
8492-8501 |
JJ |
denotes |
posterior |
T6250 |
8502-8515 |
NNS |
denotes |
probabilities |
T6252 |
8516-8518 |
IN |
denotes |
of |
T6253 |
8519-8525 |
JJ |
denotes |
inside |
T6255 |
8526-8527 |
HYPH |
denotes |
/ |
T6256 |
8527-8534 |
JJ |
denotes |
outside |
T6257 |
8534-8535 |
HYPH |
denotes |
/ |
T6254 |
8535-8537 |
NN |
denotes |
TM |
T6258 |
8538-8543 |
NN |
denotes |
helix |
T6259 |
8543-8544 |
. |
denotes |
. |
T6260 |
8544-8619 |
sentence |
denotes |
At the top of the plot (between 1 and 1.2) the N-best prediction is shown. |
T6261 |
8545-8547 |
IN |
denotes |
At |
T6263 |
8548-8551 |
DT |
denotes |
the |
T6264 |
8552-8555 |
NN |
denotes |
top |
T6265 |
8556-8558 |
IN |
denotes |
of |
T6266 |
8559-8562 |
DT |
denotes |
the |
T6267 |
8563-8567 |
NN |
denotes |
plot |
T6268 |
8568-8569 |
-LRB- |
denotes |
( |
T6269 |
8569-8576 |
IN |
denotes |
between |
T6270 |
8577-8578 |
CD |
denotes |
1 |
T6271 |
8579-8582 |
CC |
denotes |
and |
T6272 |
8583-8586 |
CD |
denotes |
1.2 |
T6273 |
8586-8587 |
-RRB- |
denotes |
) |
T6274 |
8588-8591 |
DT |
denotes |
the |
T6276 |
8592-8593 |
NN |
denotes |
N |
T6278 |
8593-8594 |
HYPH |
denotes |
- |
T6277 |
8594-8598 |
JJS |
denotes |
best |
T6275 |
8599-8609 |
NN |
denotes |
prediction |
T6279 |
8610-8612 |
VBZ |
denotes |
is |
T6262 |
8613-8618 |
VBN |
denotes |
shown |
T6280 |
8618-8619 |
. |
denotes |
. |
T6281 |
8619-8776 |
sentence |
denotes |
The plot is obtained by calculating the total probability that a residue sits in helix, inside, or outside summed over all possible paths through the model. |
T6282 |
8620-8623 |
DT |
denotes |
The |
T6283 |
8624-8628 |
NN |
denotes |
plot |
T6285 |
8629-8631 |
VBZ |
denotes |
is |
T6284 |
8632-8640 |
VBN |
denotes |
obtained |
T6286 |
8641-8643 |
IN |
denotes |
by |
T6287 |
8644-8655 |
VBG |
denotes |
calculating |
T6288 |
8656-8659 |
DT |
denotes |
the |
T6290 |
8660-8665 |
JJ |
denotes |
total |
T6289 |
8666-8677 |
NN |
denotes |
probability |
T6291 |
8678-8682 |
IN |
denotes |
that |
T6293 |
8683-8684 |
DT |
denotes |
a |
T6294 |
8685-8692 |
NN |
denotes |
residue |
T6292 |
8693-8697 |
VBZ |
denotes |
sits |
T6295 |
8698-8700 |
IN |
denotes |
in |
T6296 |
8701-8706 |
NN |
denotes |
helix |
T6297 |
8706-8708 |
, |
denotes |
, |
T6298 |
8708-8714 |
RB |
denotes |
inside |
T6299 |
8714-8716 |
, |
denotes |
, |
T6300 |
8716-8718 |
CC |
denotes |
or |
T6301 |
8719-8726 |
RB |
denotes |
outside |
T6302 |
8727-8733 |
VBD |
denotes |
summed |
T6303 |
8734-8738 |
IN |
denotes |
over |
T6304 |
8739-8742 |
DT |
denotes |
all |
T6306 |
8743-8751 |
JJ |
denotes |
possible |
T6305 |
8752-8757 |
NNS |
denotes |
paths |
T6307 |
8758-8765 |
IN |
denotes |
through |
T6308 |
8766-8769 |
DT |
denotes |
the |
T6309 |
8770-8775 |
NN |
denotes |
model |
T6310 |
8775-8776 |
. |
denotes |
. |
T2513 |
8777-8779 |
IN |
denotes |
In |
T2515 |
8780-8788 |
NN |
denotes |
addition |
T2516 |
8788-8790 |
, |
denotes |
, |
T2517 |
8790-8795 |
NN |
denotes |
Acdp1 |
T2514 |
8796-8804 |
VBZ |
denotes |
contains |
T2518 |
8805-8807 |
DT |
denotes |
an |
T2520 |
8808-8815 |
NN |
denotes |
Alanine |
T2522 |
8815-8816 |
HYPH |
denotes |
- |
T2521 |
8816-8820 |
JJ |
denotes |
rich |
T2519 |
8821-8827 |
NN |
denotes |
region |
T2523 |
8828-8829 |
-LRB- |
denotes |
( |
T2525 |
8829-8830 |
CD |
denotes |
2 |
T2526 |
8830-8831 |
SYM |
denotes |
– |
T2527 |
8831-8833 |
CD |
denotes |
10 |
T2528 |
8833-8835 |
: |
denotes |
: |
T2524 |
8835-8844 |
NN |
denotes |
AAAAAAAAA |
T2529 |
8844-8845 |
-RRB- |
denotes |
) |
T2530 |
8845-8847 |
, |
denotes |
, |
T2531 |
8847-8848 |
DT |
denotes |
a |
T2533 |
8849-8856 |
NN |
denotes |
Leucine |
T2535 |
8856-8857 |
HYPH |
denotes |
- |
T2534 |
8857-8861 |
JJ |
denotes |
rich |
T2532 |
8862-8868 |
NN |
denotes |
region |
T2536 |
8869-8870 |
-LRB- |
denotes |
( |
T2538 |
8870-8873 |
CD |
denotes |
204 |
T2539 |
8873-8874 |
SYM |
denotes |
– |
T2540 |
8874-8877 |
CD |
denotes |
257 |
T2541 |
8877-8879 |
: |
denotes |
: |
T2542 |
8879-8915 |
NN |
denotes |
LLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALF |
T2537 |
8916-8934 |
NN |
denotes |
SGLRLSLLSLDPVELRVL |
T2543 |
8934-8935 |
-RRB- |
denotes |
) |
T2544 |
8935-8937 |
, |
denotes |
, |
T2545 |
8937-8938 |
DT |
denotes |
a |
T2547 |
8939-8946 |
NN |
denotes |
Proline |
T2549 |
8946-8947 |
HYPH |
denotes |
- |
T2548 |
8947-8951 |
JJ |
denotes |
rich |
T2546 |
8952-8958 |
NN |
denotes |
region |
T2550 |
8959-8960 |
-LRB- |
denotes |
( |
T2552 |
8960-8962 |
CD |
denotes |
78 |
T2553 |
8962-8963 |
SYM |
denotes |
– |
T2554 |
8963-8966 |
CD |
denotes |
130 |
T2555 |
8966-8968 |
: |
denotes |
: |
T2556 |
8968-8984 |
NN |
denotes |
PGPPVPAAPVPAPSLA |
T2551 |
8985-9022 |
NN |
denotes |
PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
T2557 |
9022-9023 |
-RRB- |
denotes |
) |
T2558 |
9023-9025 |
, |
denotes |
, |
T2559 |
9025-9028 |
CC |
denotes |
and |
T2560 |
9029-9032 |
CD |
denotes |
two |
T2562 |
9033-9042 |
NN |
denotes |
amidation |
T2561 |
9043-9048 |
NNS |
denotes |
sites |
T2563 |
9049-9050 |
-LRB- |
denotes |
( |
T2565 |
9050-9053 |
CD |
denotes |
917 |
T2567 |
9053-9054 |
SYM |
denotes |
– |
T2568 |
9054-9057 |
CD |
denotes |
920 |
T2569 |
9057-9059 |
: |
denotes |
: |
T2566 |
9059-9063 |
NN |
denotes |
MGKK |
T2570 |
9063-9064 |
: |
denotes |
; |
T2571 |
9065-9068 |
CD |
denotes |
926 |
T2572 |
9068-9069 |
SYM |
denotes |
– |
T2573 |
9069-9072 |
CD |
denotes |
929 |
T2574 |
9072-9074 |
: |
denotes |
: |
T2564 |
9074-9078 |
NN |
denotes |
SGRK |
T2575 |
9078-9079 |
-RRB- |
denotes |
) |
T2576 |
9079-9080 |
. |
denotes |
. |
T2577 |
9080-9147 |
sentence |
denotes |
Acdp2 has a glycine-rich region (201–222: GAGGSGSASGTVGGKGGAGVAG). |
T2578 |
9081-9086 |
NN |
denotes |
Acdp2 |
T2579 |
9087-9090 |
VBZ |
denotes |
has |
T2580 |
9091-9092 |
DT |
denotes |
a |
T2582 |
9093-9100 |
NN |
denotes |
glycine |
T2584 |
9100-9101 |
HYPH |
denotes |
- |
T2583 |
9101-9105 |
JJ |
denotes |
rich |
T2581 |
9106-9112 |
NN |
denotes |
region |
T2585 |
9113-9114 |
-LRB- |
denotes |
( |
T2587 |
9114-9117 |
CD |
denotes |
201 |
T2588 |
9117-9118 |
SYM |
denotes |
– |
T2589 |
9118-9121 |
CD |
denotes |
222 |
T2590 |
9121-9123 |
: |
denotes |
: |
T2586 |
9123-9145 |
NN |
denotes |
GAGGSGSASGTVGGKGGAGVAG |
T2591 |
9145-9146 |
-RRB- |
denotes |
) |
T2592 |
9146-9147 |
. |
denotes |
. |
T2593 |
9147-9242 |
sentence |
denotes |
Acdp3 possesses a large alanine-rich region (2–261) and a large leucine-rich region (201–299). |
T2594 |
9148-9153 |
NN |
denotes |
Acdp3 |
T2595 |
9154-9163 |
VBZ |
denotes |
possesses |
T2596 |
9164-9165 |
DT |
denotes |
a |
T2598 |
9166-9171 |
JJ |
denotes |
large |
T2599 |
9172-9179 |
NN |
denotes |
alanine |
T2601 |
9179-9180 |
HYPH |
denotes |
- |
T2600 |
9180-9184 |
JJ |
denotes |
rich |
T2597 |
9185-9191 |
NN |
denotes |
region |
T2602 |
9192-9193 |
-LRB- |
denotes |
( |
T2603 |
9193-9194 |
CD |
denotes |
2 |
T2604 |
9194-9195 |
SYM |
denotes |
– |
T2605 |
9195-9198 |
CD |
denotes |
261 |
T2606 |
9198-9199 |
-RRB- |
denotes |
) |
T2607 |
9200-9203 |
CC |
denotes |
and |
T2608 |
9204-9205 |
DT |
denotes |
a |
T2610 |
9206-9211 |
JJ |
denotes |
large |
T2611 |
9212-9219 |
NN |
denotes |
leucine |
T2613 |
9219-9220 |
HYPH |
denotes |
- |
T2612 |
9220-9224 |
JJ |
denotes |
rich |
T2609 |
9225-9231 |
NN |
denotes |
region |
T2614 |
9232-9233 |
-LRB- |
denotes |
( |
T2615 |
9233-9236 |
CD |
denotes |
201 |
T2616 |
9236-9237 |
SYM |
denotes |
– |
T2617 |
9237-9240 |
CD |
denotes |
299 |
T2618 |
9240-9241 |
-RRB- |
denotes |
) |
T2619 |
9241-9242 |
. |
denotes |
. |
T2620 |
9242-9352 |
sentence |
denotes |
Acdp4 contains a leucine zipper pattern (185–206: LVMVLLVLSGIFSGLNLGLMAL) and an amidation site (7–10: GGRR). |
T2621 |
9243-9248 |
NN |
denotes |
Acdp4 |
T2622 |
9249-9257 |
VBZ |
denotes |
contains |
T2623 |
9258-9259 |
DT |
denotes |
a |
T2625 |
9260-9267 |
NN |
denotes |
leucine |
T2626 |
9268-9274 |
NN |
denotes |
zipper |
T2624 |
9275-9282 |
NN |
denotes |
pattern |
T2627 |
9283-9284 |
-LRB- |
denotes |
( |
T2629 |
9284-9287 |
CD |
denotes |
185 |
T2630 |
9287-9288 |
SYM |
denotes |
– |
T2631 |
9288-9291 |
CD |
denotes |
206 |
T2632 |
9291-9293 |
: |
denotes |
: |
T2628 |
9293-9315 |
NN |
denotes |
LVMVLLVLSGIFSGLNLGLMAL |
T2633 |
9315-9316 |
-RRB- |
denotes |
) |
T2634 |
9317-9320 |
CC |
denotes |
and |
T2635 |
9321-9323 |
DT |
denotes |
an |
T2637 |
9324-9333 |
NN |
denotes |
amidation |
T2636 |
9334-9338 |
NN |
denotes |
site |
T2638 |
9339-9340 |
-LRB- |
denotes |
( |
T2640 |
9340-9341 |
CD |
denotes |
7 |
T2641 |
9341-9342 |
SYM |
denotes |
– |
T2642 |
9342-9344 |
CD |
denotes |
10 |
T2643 |
9344-9346 |
: |
denotes |
: |
T2639 |
9346-9350 |
NN |
denotes |
GGRR |
T2644 |
9350-9351 |
-RRB- |
denotes |
) |
T2645 |
9351-9352 |
. |
denotes |
. |
T2862 |
9354-9362 |
NN |
denotes |
Antibody |
T2863 |
9363-9373 |
NN |
denotes |
production |
T2864 |
9373-9375 |
, |
denotes |
, |
T2865 |
9375-9382 |
NNP |
denotes |
Western |
T2866 |
9383-9390 |
NNS |
denotes |
results |
T2867 |
9391-9394 |
CC |
denotes |
and |
T2868 |
9395-9406 |
JJ |
denotes |
subcellular |
T2869 |
9407-9419 |
NN |
denotes |
localization |
T2870 |
9419-9627 |
sentence |
denotes |
Peptides from Acdp1 N- (TSFLLRVYFQPGPPATAAPVPSPT) and C- (TQQLTLSPAAVPTR) terminuses, conserved peptide from ACD domain of Acdp1 (HNIVDILFVKDLAFVDPDDCTPLLTVTRF) were commercially synthesized (Sigma Genosys). |
T2871 |
9420-9428 |
NNS |
denotes |
Peptides |
T2873 |
9429-9433 |
IN |
denotes |
from |
T2874 |
9434-9439 |
NN |
denotes |
Acdp1 |
T2876 |
9440-9441 |
NN |
denotes |
N |
T2877 |
9441-9442 |
HYPH |
denotes |
- |
T2878 |
9443-9444 |
-LRB- |
denotes |
( |
T2879 |
9444-9468 |
NN |
denotes |
TSFLLRVYFQPGPPATAAPVPSPT |
T2880 |
9468-9469 |
-RRB- |
denotes |
) |
T2881 |
9470-9473 |
CC |
denotes |
and |
T2882 |
9474-9475 |
NN |
denotes |
C |
T2883 |
9475-9476 |
HYPH |
denotes |
- |
T2884 |
9477-9478 |
-LRB- |
denotes |
( |
T2885 |
9478-9492 |
NN |
denotes |
TQQLTLSPAAVPTR |
T2886 |
9492-9493 |
-RRB- |
denotes |
) |
T2875 |
9494-9504 |
NNS |
denotes |
terminuses |
T2887 |
9504-9506 |
, |
denotes |
, |
T2888 |
9506-9515 |
JJ |
denotes |
conserved |
T2889 |
9516-9523 |
NN |
denotes |
peptide |
T2890 |
9524-9528 |
IN |
denotes |
from |
T2891 |
9529-9532 |
NN |
denotes |
ACD |
T2892 |
9533-9539 |
NN |
denotes |
domain |
T2893 |
9540-9542 |
IN |
denotes |
of |
T2894 |
9543-9548 |
NN |
denotes |
Acdp1 |
T2895 |
9549-9550 |
-LRB- |
denotes |
( |
T2896 |
9550-9579 |
NN |
denotes |
HNIVDILFVKDLAFVDPDDCTPLLTVTRF |
T2897 |
9579-9580 |
-RRB- |
denotes |
) |
T2898 |
9581-9585 |
VBD |
denotes |
were |
T2899 |
9586-9598 |
RB |
denotes |
commercially |
T2872 |
9599-9610 |
VBN |
denotes |
synthesized |
T2900 |
9611-9612 |
-LRB- |
denotes |
( |
T2902 |
9612-9617 |
NNP |
denotes |
Sigma |
T2901 |
9618-9625 |
NNP |
denotes |
Genosys |
T2903 |
9625-9626 |
-RRB- |
denotes |
) |
T2904 |
9626-9627 |
. |
denotes |
. |
T2905 |
9627-9775 |
sentence |
denotes |
These antigenic sites were predicted by software from Sigma Genosys and polyclonal antibodies for each peptide were produced by immunizing rabbits. |
T2906 |
9628-9633 |
DT |
denotes |
These |
T2908 |
9634-9643 |
JJ |
denotes |
antigenic |
T2907 |
9644-9649 |
NNS |
denotes |
sites |
T2910 |
9650-9654 |
VBD |
denotes |
were |
T2909 |
9655-9664 |
VBN |
denotes |
predicted |
T2911 |
9665-9667 |
IN |
denotes |
by |
T2912 |
9668-9676 |
NN |
denotes |
software |
T2913 |
9677-9681 |
IN |
denotes |
from |
T2914 |
9682-9687 |
NNP |
denotes |
Sigma |
T2915 |
9688-9695 |
NNP |
denotes |
Genosys |
T2916 |
9696-9699 |
CC |
denotes |
and |
T2917 |
9700-9710 |
JJ |
denotes |
polyclonal |
T2918 |
9711-9721 |
NNS |
denotes |
antibodies |
T2920 |
9722-9725 |
IN |
denotes |
for |
T2921 |
9726-9730 |
DT |
denotes |
each |
T2922 |
9731-9738 |
NN |
denotes |
peptide |
T2923 |
9739-9743 |
VBD |
denotes |
were |
T2919 |
9744-9752 |
VBN |
denotes |
produced |
T2924 |
9753-9755 |
IN |
denotes |
by |
T2925 |
9756-9766 |
VBG |
denotes |
immunizing |
T2926 |
9767-9774 |
NNS |
denotes |
rabbits |
T2927 |
9774-9775 |
. |
denotes |
. |
T2928 |
9775-9885 |
sentence |
denotes |
To test the specificity of the antibodies, we conducted Western-blot analysis of mouse brain tissue extracts. |
T2929 |
9776-9778 |
TO |
denotes |
To |
T2930 |
9779-9783 |
VB |
denotes |
test |
T2932 |
9784-9787 |
DT |
denotes |
the |
T2933 |
9788-9799 |
NN |
denotes |
specificity |
T2934 |
9800-9802 |
IN |
denotes |
of |
T2935 |
9803-9806 |
DT |
denotes |
the |
T2936 |
9807-9817 |
NNS |
denotes |
antibodies |
T2937 |
9817-9819 |
, |
denotes |
, |
T2938 |
9819-9821 |
PRP |
denotes |
we |
T2931 |
9822-9831 |
VBD |
denotes |
conducted |
T2939 |
9832-9839 |
NNP |
denotes |
Western |
T2941 |
9839-9840 |
HYPH |
denotes |
- |
T2940 |
9840-9844 |
NN |
denotes |
blot |
T2942 |
9845-9853 |
NN |
denotes |
analysis |
T2943 |
9854-9856 |
IN |
denotes |
of |
T2944 |
9857-9862 |
NN |
denotes |
mouse |
T2945 |
9863-9868 |
NN |
denotes |
brain |
T2946 |
9869-9875 |
NN |
denotes |
tissue |
T2947 |
9876-9884 |
NNS |
denotes |
extracts |
T2948 |
9884-9885 |
. |
denotes |
. |
T2949 |
9885-9988 |
sentence |
denotes |
As shown in Fig. 6A, the antibody produced by C-terminal peptide specifically detected Acdp1 (lane 3). |
T2950 |
9886-9888 |
IN |
denotes |
As |
T2951 |
9889-9894 |
VBN |
denotes |
shown |
T2953 |
9895-9897 |
IN |
denotes |
in |
T2954 |
9898-9902 |
NN |
denotes |
Fig. |
T2955 |
9903-9905 |
CD |
denotes |
6A |
T2956 |
9905-9907 |
, |
denotes |
, |
T2957 |
9907-9910 |
DT |
denotes |
the |
T2958 |
9911-9919 |
NN |
denotes |
antibody |
T2959 |
9920-9928 |
VBN |
denotes |
produced |
T2960 |
9929-9931 |
IN |
denotes |
by |
T2961 |
9932-9933 |
NN |
denotes |
C |
T2963 |
9933-9934 |
HYPH |
denotes |
- |
T2964 |
9934-9942 |
JJ |
denotes |
terminal |
T2962 |
9943-9950 |
NN |
denotes |
peptide |
T2965 |
9951-9963 |
RB |
denotes |
specifically |
T2952 |
9964-9972 |
VBD |
denotes |
detected |
T2966 |
9973-9978 |
NN |
denotes |
Acdp1 |
T2967 |
9979-9980 |
-LRB- |
denotes |
( |
T2968 |
9980-9984 |
NN |
denotes |
lane |
T2969 |
9985-9986 |
CD |
denotes |
3 |
T2970 |
9986-9987 |
-RRB- |
denotes |
) |
T2971 |
9987-9988 |
. |
denotes |
. |
T2972 |
9988-10150 |
sentence |
denotes |
The antibody generated by N-terminal peptide recognized Acdp4 in addition to Acdp1, although the reactivity to latter was significantly higher (Fig. 6A, lane 2). |
T2973 |
9989-9992 |
DT |
denotes |
The |
T2974 |
9993-10001 |
NN |
denotes |
antibody |
T2976 |
10002-10011 |
VBN |
denotes |
generated |
T2977 |
10012-10014 |
IN |
denotes |
by |
T2978 |
10015-10016 |
NN |
denotes |
N |
T2980 |
10016-10017 |
HYPH |
denotes |
- |
T2981 |
10017-10025 |
JJ |
denotes |
terminal |
T2979 |
10026-10033 |
NN |
denotes |
peptide |
T2975 |
10034-10044 |
VBD |
denotes |
recognized |
T2982 |
10045-10050 |
NN |
denotes |
Acdp4 |
T2983 |
10051-10053 |
IN |
denotes |
in |
T2984 |
10054-10062 |
NN |
denotes |
addition |
T2985 |
10063-10065 |
IN |
denotes |
to |
T2986 |
10066-10071 |
NN |
denotes |
Acdp1 |
T2987 |
10071-10073 |
, |
denotes |
, |
T2988 |
10073-10081 |
IN |
denotes |
although |
T2990 |
10082-10085 |
DT |
denotes |
the |
T2991 |
10086-10096 |
NN |
denotes |
reactivity |
T2992 |
10097-10099 |
IN |
denotes |
to |
T2993 |
10100-10106 |
NN |
denotes |
latter |
T2989 |
10107-10110 |
VBD |
denotes |
was |
T2994 |
10111-10124 |
RB |
denotes |
significantly |
T2995 |
10125-10131 |
JJR |
denotes |
higher |
T2996 |
10132-10133 |
-LRB- |
denotes |
( |
T2998 |
10133-10137 |
NN |
denotes |
Fig. |
T2999 |
10138-10140 |
CD |
denotes |
6A |
T3000 |
10140-10142 |
, |
denotes |
, |
T2997 |
10142-10146 |
NN |
denotes |
lane |
T3001 |
10147-10148 |
CD |
denotes |
2 |
T3002 |
10148-10149 |
-RRB- |
denotes |
) |
T3003 |
10149-10150 |
. |
denotes |
. |
T3004 |
10150-10265 |
sentence |
denotes |
As expected, the antibody produced by the conserved sequence peptide detected all Acdp proteins (Fig. 6A, lane 1). |
T3005 |
10151-10153 |
IN |
denotes |
As |
T3006 |
10154-10162 |
VBN |
denotes |
expected |
T3008 |
10162-10164 |
, |
denotes |
, |
T3009 |
10164-10167 |
DT |
denotes |
the |
T3010 |
10168-10176 |
NN |
denotes |
antibody |
T3011 |
10177-10185 |
VBN |
denotes |
produced |
T3012 |
10186-10188 |
IN |
denotes |
by |
T3013 |
10189-10192 |
DT |
denotes |
the |
T3015 |
10193-10202 |
VBN |
denotes |
conserved |
T3016 |
10203-10211 |
NN |
denotes |
sequence |
T3014 |
10212-10219 |
NN |
denotes |
peptide |
T3007 |
10220-10228 |
VBD |
denotes |
detected |
T3017 |
10229-10232 |
DT |
denotes |
all |
T3019 |
10233-10237 |
NN |
denotes |
Acdp |
T3018 |
10238-10246 |
NN |
denotes |
proteins |
T3020 |
10247-10248 |
-LRB- |
denotes |
( |
T3022 |
10248-10252 |
NN |
denotes |
Fig. |
T3023 |
10253-10255 |
CD |
denotes |
6A |
T3024 |
10255-10257 |
, |
denotes |
, |
T3021 |
10257-10261 |
NN |
denotes |
lane |
T3025 |
10262-10263 |
CD |
denotes |
1 |
T3026 |
10263-10264 |
-RRB- |
denotes |
) |
T3027 |
10264-10265 |
. |
denotes |
. |
T3028 |
10265-10400 |
sentence |
denotes |
To further determine the specificity of the antibody against the Acdp1 C-terminus, we analyzed extracts of HEK293, 3T3 and PC12 cells. |
T3029 |
10266-10268 |
TO |
denotes |
To |
T3031 |
10269-10276 |
RB |
denotes |
further |
T3030 |
10277-10286 |
VB |
denotes |
determine |
T3033 |
10287-10290 |
DT |
denotes |
the |
T3034 |
10291-10302 |
NN |
denotes |
specificity |
T3035 |
10303-10305 |
IN |
denotes |
of |
T3036 |
10306-10309 |
DT |
denotes |
the |
T3037 |
10310-10318 |
NN |
denotes |
antibody |
T3038 |
10319-10326 |
IN |
denotes |
against |
T3039 |
10327-10330 |
DT |
denotes |
the |
T3041 |
10331-10336 |
NN |
denotes |
Acdp1 |
T3042 |
10337-10338 |
NN |
denotes |
C |
T3043 |
10338-10339 |
HYPH |
denotes |
- |
T3040 |
10339-10347 |
NN |
denotes |
terminus |
T3044 |
10347-10349 |
, |
denotes |
, |
T3045 |
10349-10351 |
PRP |
denotes |
we |
T3032 |
10352-10360 |
VBD |
denotes |
analyzed |
T3046 |
10361-10369 |
NNS |
denotes |
extracts |
T3047 |
10370-10372 |
IN |
denotes |
of |
T3048 |
10373-10379 |
NN |
denotes |
HEK293 |
T3050 |
10379-10381 |
, |
denotes |
, |
T3051 |
10381-10384 |
NN |
denotes |
3T3 |
T3052 |
10385-10388 |
CC |
denotes |
and |
T3053 |
10389-10393 |
NN |
denotes |
PC12 |
T3049 |
10394-10399 |
NNS |
denotes |
cells |
T3054 |
10399-10400 |
. |
denotes |
. |
T3055 |
10400-10434 |
sentence |
denotes |
The results are shown in Fig. 6B. |
T3056 |
10401-10404 |
DT |
denotes |
The |
T3057 |
10405-10412 |
NNS |
denotes |
results |
T3059 |
10413-10416 |
VBP |
denotes |
are |
T3058 |
10417-10422 |
VBN |
denotes |
shown |
T3060 |
10423-10425 |
IN |
denotes |
in |
T3061 |
10426-10430 |
NN |
denotes |
Fig. |
T3062 |
10431-10433 |
CD |
denotes |
6B |
T3063 |
10433-10434 |
. |
denotes |
. |
T3064 |
10434-10515 |
sentence |
denotes |
Apparently, this antibody detected a specific band of Acdp1 in all cell lysates. |
T3065 |
10435-10445 |
RB |
denotes |
Apparently |
T3067 |
10445-10447 |
, |
denotes |
, |
T3068 |
10447-10451 |
DT |
denotes |
this |
T3069 |
10452-10460 |
NN |
denotes |
antibody |
T3066 |
10461-10469 |
VBD |
denotes |
detected |
T3070 |
10470-10471 |
DT |
denotes |
a |
T3072 |
10472-10480 |
JJ |
denotes |
specific |
T3071 |
10481-10485 |
NN |
denotes |
band |
T3073 |
10486-10488 |
IN |
denotes |
of |
T3074 |
10489-10494 |
NN |
denotes |
Acdp1 |
T3075 |
10495-10497 |
IN |
denotes |
in |
T3076 |
10498-10501 |
DT |
denotes |
all |
T3078 |
10502-10506 |
NN |
denotes |
cell |
T3077 |
10507-10514 |
NNS |
denotes |
lysates |
T3079 |
10514-10515 |
. |
denotes |
. |
T3080 |
10515-10641 |
sentence |
denotes |
Of note, shown in Fig. 6B are signals of 10 μg extracts of HEK293 cell lysates, 100 μg extracts of 3T3 and PC12 cell lysates. |
T3081 |
10516-10518 |
IN |
denotes |
Of |
T3083 |
10519-10523 |
NN |
denotes |
note |
T3084 |
10523-10525 |
, |
denotes |
, |
T3085 |
10525-10530 |
VBN |
denotes |
shown |
T3086 |
10531-10533 |
IN |
denotes |
in |
T3087 |
10534-10538 |
NN |
denotes |
Fig. |
T3088 |
10539-10541 |
CD |
denotes |
6B |
T3082 |
10542-10545 |
VBP |
denotes |
are |
T3089 |
10546-10553 |
NNS |
denotes |
signals |
T3090 |
10554-10556 |
IN |
denotes |
of |
T3091 |
10557-10559 |
CD |
denotes |
10 |
T3092 |
10560-10562 |
NN |
denotes |
μg |
T3093 |
10563-10571 |
NNS |
denotes |
extracts |
T3094 |
10572-10574 |
IN |
denotes |
of |
T3095 |
10575-10581 |
NN |
denotes |
HEK293 |
T3097 |
10582-10586 |
NN |
denotes |
cell |
T3096 |
10587-10594 |
NNS |
denotes |
lysates |
T3098 |
10594-10596 |
, |
denotes |
, |
T3099 |
10596-10599 |
CD |
denotes |
100 |
T3100 |
10600-10602 |
NN |
denotes |
μg |
T3101 |
10603-10611 |
NNS |
denotes |
extracts |
T3102 |
10612-10614 |
IN |
denotes |
of |
T3103 |
10615-10618 |
NN |
denotes |
3T3 |
T3105 |
10619-10622 |
CC |
denotes |
and |
T3106 |
10623-10627 |
NN |
denotes |
PC12 |
T3107 |
10628-10632 |
NN |
denotes |
cell |
T3104 |
10633-10640 |
NNS |
denotes |
lysates |
T3108 |
10640-10641 |
. |
denotes |
. |
T3109 |
10641-10755 |
sentence |
denotes |
Thus, the expression levels of Acdp1 in these cell types vary a lot, with the highest expression in HEK293 cells. |
T3110 |
10642-10646 |
RB |
denotes |
Thus |
T3112 |
10646-10648 |
, |
denotes |
, |
T3113 |
10648-10651 |
DT |
denotes |
the |
T3115 |
10652-10662 |
NN |
denotes |
expression |
T3114 |
10663-10669 |
NNS |
denotes |
levels |
T3116 |
10670-10672 |
IN |
denotes |
of |
T3117 |
10673-10678 |
NN |
denotes |
Acdp1 |
T3118 |
10679-10681 |
IN |
denotes |
in |
T3119 |
10682-10687 |
DT |
denotes |
these |
T3121 |
10688-10692 |
NN |
denotes |
cell |
T3120 |
10693-10698 |
NNS |
denotes |
types |
T3111 |
10699-10703 |
VBP |
denotes |
vary |
T3122 |
10704-10705 |
DT |
denotes |
a |
T3123 |
10706-10709 |
NN |
denotes |
lot |
T3124 |
10709-10711 |
, |
denotes |
, |
T3125 |
10711-10715 |
IN |
denotes |
with |
T3126 |
10716-10719 |
DT |
denotes |
the |
T3128 |
10720-10727 |
JJS |
denotes |
highest |
T3127 |
10728-10738 |
NN |
denotes |
expression |
T3129 |
10739-10741 |
IN |
denotes |
in |
T3130 |
10742-10748 |
NN |
denotes |
HEK293 |
T3131 |
10749-10754 |
NNS |
denotes |
cells |
T3132 |
10754-10755 |
. |
denotes |
. |
T3133 |
10755-10915 |
sentence |
denotes |
Nevertheless, these immunoblot results support our analysis of brain tissue extracts that the antibody against Acdp1 C-terminus specifically recognizes Acdp-1. |
T3134 |
10756-10768 |
RB |
denotes |
Nevertheless |
T3136 |
10768-10770 |
, |
denotes |
, |
T3137 |
10770-10775 |
DT |
denotes |
these |
T3139 |
10776-10786 |
NN |
denotes |
immunoblot |
T3138 |
10787-10794 |
NNS |
denotes |
results |
T3135 |
10795-10802 |
VBP |
denotes |
support |
T3140 |
10803-10806 |
PRP$ |
denotes |
our |
T3141 |
10807-10815 |
NN |
denotes |
analysis |
T3142 |
10816-10818 |
IN |
denotes |
of |
T3143 |
10819-10824 |
NN |
denotes |
brain |
T3145 |
10825-10831 |
NN |
denotes |
tissue |
T3144 |
10832-10840 |
NNS |
denotes |
extracts |
T3146 |
10841-10845 |
IN |
denotes |
that |
T3148 |
10846-10849 |
DT |
denotes |
the |
T3149 |
10850-10858 |
NN |
denotes |
antibody |
T3150 |
10859-10866 |
IN |
denotes |
against |
T3151 |
10867-10872 |
NN |
denotes |
Acdp1 |
T3153 |
10873-10874 |
NN |
denotes |
C |
T3154 |
10874-10875 |
HYPH |
denotes |
- |
T3152 |
10875-10883 |
NN |
denotes |
terminus |
T3155 |
10884-10896 |
RB |
denotes |
specifically |
T3147 |
10897-10907 |
VBZ |
denotes |
recognizes |
T3156 |
10908-10912 |
NN |
denotes |
Acdp |
T3157 |
10912-10913 |
HYPH |
denotes |
- |
T3158 |
10913-10914 |
CD |
denotes |
1 |
T3159 |
10914-10915 |
. |
denotes |
. |
T3160 |
10915-11034 |
sentence |
denotes |
The specificity of the Acdp1 C-terminus antibody suggests the possibility of using it to localize Acdp-1 within cells. |
T3161 |
10916-10919 |
DT |
denotes |
The |
T3162 |
10920-10931 |
NN |
denotes |
specificity |
T3164 |
10932-10934 |
IN |
denotes |
of |
T3165 |
10935-10938 |
DT |
denotes |
the |
T3167 |
10939-10944 |
NN |
denotes |
Acdp1 |
T3168 |
10945-10946 |
NN |
denotes |
C |
T3170 |
10946-10947 |
HYPH |
denotes |
- |
T3169 |
10947-10955 |
NN |
denotes |
terminus |
T3166 |
10956-10964 |
NN |
denotes |
antibody |
T3163 |
10965-10973 |
VBZ |
denotes |
suggests |
T3171 |
10974-10977 |
DT |
denotes |
the |
T3172 |
10978-10989 |
NN |
denotes |
possibility |
T3173 |
10990-10992 |
IN |
denotes |
of |
T3174 |
10993-10998 |
VBG |
denotes |
using |
T3175 |
10999-11001 |
PRP |
denotes |
it |
T3176 |
11002-11004 |
TO |
denotes |
to |
T3177 |
11005-11013 |
VB |
denotes |
localize |
T3178 |
11014-11018 |
NN |
denotes |
Acdp |
T3179 |
11018-11019 |
HYPH |
denotes |
- |
T3180 |
11019-11020 |
CD |
denotes |
1 |
T3181 |
11021-11027 |
IN |
denotes |
within |
T3182 |
11028-11033 |
NNS |
denotes |
cells |
T3183 |
11033-11034 |
. |
denotes |
. |
T3184 |
11034-11207 |
sentence |
denotes |
Since Northern blot revealed almost exclusive expression of Acdp1 in the brain, we examined its subcellular localization in hippocampus neurons isolated from mouse embryos. |
T3185 |
11035-11040 |
IN |
denotes |
Since |
T3187 |
11041-11049 |
NNP |
denotes |
Northern |
T3188 |
11050-11054 |
NN |
denotes |
blot |
T3186 |
11055-11063 |
VBD |
denotes |
revealed |
T3190 |
11064-11070 |
RB |
denotes |
almost |
T3191 |
11071-11080 |
JJ |
denotes |
exclusive |
T3192 |
11081-11091 |
NN |
denotes |
expression |
T3193 |
11092-11094 |
IN |
denotes |
of |
T3194 |
11095-11100 |
NN |
denotes |
Acdp1 |
T3195 |
11101-11103 |
IN |
denotes |
in |
T3196 |
11104-11107 |
DT |
denotes |
the |
T3197 |
11108-11113 |
NN |
denotes |
brain |
T3198 |
11113-11115 |
, |
denotes |
, |
T3199 |
11115-11117 |
PRP |
denotes |
we |
T3189 |
11118-11126 |
VBD |
denotes |
examined |
T3200 |
11127-11130 |
PRP$ |
denotes |
its |
T3202 |
11131-11142 |
JJ |
denotes |
subcellular |
T3201 |
11143-11155 |
NN |
denotes |
localization |
T3203 |
11156-11158 |
IN |
denotes |
in |
T3204 |
11159-11170 |
NN |
denotes |
hippocampus |
T3205 |
11171-11178 |
NNS |
denotes |
neurons |
T3206 |
11179-11187 |
VBN |
denotes |
isolated |
T3207 |
11188-11192 |
IN |
denotes |
from |
T3208 |
11193-11198 |
NN |
denotes |
mouse |
T3209 |
11199-11206 |
NNS |
denotes |
embryos |
T3210 |
11206-11207 |
. |
denotes |
. |
T3211 |
11207-11327 |
sentence |
denotes |
The neurons were cultured on glass coverslips coated with a confluent monolayer of mouse cortical astrocytes in dishes. |
T3212 |
11208-11211 |
DT |
denotes |
The |
T3213 |
11212-11219 |
NNS |
denotes |
neurons |
T3215 |
11220-11224 |
VBD |
denotes |
were |
T3214 |
11225-11233 |
VBN |
denotes |
cultured |
T3216 |
11234-11236 |
IN |
denotes |
on |
T3217 |
11237-11242 |
NN |
denotes |
glass |
T3218 |
11243-11253 |
NNS |
denotes |
coverslips |
T3219 |
11254-11260 |
VBN |
denotes |
coated |
T3220 |
11261-11265 |
IN |
denotes |
with |
T3221 |
11266-11267 |
DT |
denotes |
a |
T3223 |
11268-11277 |
JJ |
denotes |
confluent |
T3222 |
11278-11287 |
NN |
denotes |
monolayer |
T3224 |
11288-11290 |
IN |
denotes |
of |
T3225 |
11291-11296 |
NN |
denotes |
mouse |
T3227 |
11297-11305 |
JJ |
denotes |
cortical |
T3226 |
11306-11316 |
NNS |
denotes |
astrocytes |
T3228 |
11317-11319 |
IN |
denotes |
in |
T3229 |
11320-11326 |
NNS |
denotes |
dishes |
T3230 |
11326-11327 |
. |
denotes |
. |
T3231 |
11327-11392 |
sentence |
denotes |
Immunostaining was using the Acdp1 C-terminus specific antibody. |
T3232 |
11328-11342 |
NN |
denotes |
Immunostaining |
T3234 |
11343-11346 |
VBD |
denotes |
was |
T3233 |
11347-11352 |
VBG |
denotes |
using |
T3235 |
11353-11356 |
DT |
denotes |
the |
T3237 |
11357-11362 |
NN |
denotes |
Acdp1 |
T3238 |
11363-11364 |
NN |
denotes |
C |
T3240 |
11364-11365 |
HYPH |
denotes |
- |
T3239 |
11365-11373 |
NN |
denotes |
terminus |
T3241 |
11374-11382 |
JJ |
denotes |
specific |
T3236 |
11383-11391 |
NN |
denotes |
antibody |
T3242 |
11391-11392 |
. |
denotes |
. |
T3243 |
11392-11480 |
sentence |
denotes |
Confocal imaging revealed that Acdp1 is predominantly localized on the plasma membrane. |
T3244 |
11393-11401 |
JJ |
denotes |
Confocal |
T3245 |
11402-11409 |
NN |
denotes |
imaging |
T3246 |
11410-11418 |
VBD |
denotes |
revealed |
T3247 |
11419-11423 |
IN |
denotes |
that |
T3249 |
11424-11429 |
NN |
denotes |
Acdp1 |
T3250 |
11430-11432 |
VBZ |
denotes |
is |
T3251 |
11433-11446 |
RB |
denotes |
predominantly |
T3248 |
11447-11456 |
VBN |
denotes |
localized |
T3252 |
11457-11459 |
IN |
denotes |
on |
T3253 |
11460-11463 |
DT |
denotes |
the |
T3255 |
11464-11470 |
NN |
denotes |
plasma |
T3254 |
11471-11479 |
NN |
denotes |
membrane |
T3256 |
11479-11480 |
. |
denotes |
. |
T3257 |
11480-11707 |
sentence |
denotes |
A series of sections of a cell at the thickness of 0.5 micrometer clearly showed membrane location of Acdp1-immunoreactivity (Fig. 7), which is consistent with the observation of transmembrane domains within the Acdp proteins. |
T3258 |
11481-11482 |
DT |
denotes |
A |
T3259 |
11483-11489 |
NN |
denotes |
series |
T3261 |
11490-11492 |
IN |
denotes |
of |
T3262 |
11493-11501 |
NNS |
denotes |
sections |
T3263 |
11502-11504 |
IN |
denotes |
of |
T3264 |
11505-11506 |
DT |
denotes |
a |
T3265 |
11507-11511 |
NN |
denotes |
cell |
T3266 |
11512-11514 |
IN |
denotes |
at |
T3267 |
11515-11518 |
DT |
denotes |
the |
T3268 |
11519-11528 |
NN |
denotes |
thickness |
T3269 |
11529-11531 |
IN |
denotes |
of |
T3270 |
11532-11535 |
CD |
denotes |
0.5 |
T3271 |
11536-11546 |
NN |
denotes |
micrometer |
T3272 |
11547-11554 |
RB |
denotes |
clearly |
T3260 |
11555-11561 |
VBD |
denotes |
showed |
T3273 |
11562-11570 |
NN |
denotes |
membrane |
T3274 |
11571-11579 |
NN |
denotes |
location |
T3275 |
11580-11582 |
IN |
denotes |
of |
T3276 |
11583-11588 |
NN |
denotes |
Acdp1 |
T3278 |
11588-11589 |
HYPH |
denotes |
- |
T3277 |
11589-11605 |
NN |
denotes |
immunoreactivity |
T3279 |
11606-11607 |
-LRB- |
denotes |
( |
T3280 |
11607-11611 |
NN |
denotes |
Fig. |
T3281 |
11612-11613 |
CD |
denotes |
7 |
T3282 |
11613-11614 |
-RRB- |
denotes |
) |
T3283 |
11614-11616 |
, |
denotes |
, |
T3284 |
11616-11621 |
WDT |
denotes |
which |
T3285 |
11622-11624 |
VBZ |
denotes |
is |
T3286 |
11625-11635 |
JJ |
denotes |
consistent |
T3287 |
11636-11640 |
IN |
denotes |
with |
T3288 |
11641-11644 |
DT |
denotes |
the |
T3289 |
11645-11656 |
NN |
denotes |
observation |
T3290 |
11657-11659 |
IN |
denotes |
of |
T3291 |
11660-11673 |
NN |
denotes |
transmembrane |
T3292 |
11674-11681 |
NNS |
denotes |
domains |
T3293 |
11682-11688 |
IN |
denotes |
within |
T3294 |
11689-11692 |
DT |
denotes |
the |
T3296 |
11693-11697 |
NN |
denotes |
Acdp |
T3295 |
11698-11706 |
NN |
denotes |
proteins |
T3297 |
11706-11707 |
. |
denotes |
. |
T6368 |
11718-11722 |
NN |
denotes |
Fig. |
T6370 |
11723-11725 |
CD |
denotes |
6A |
T6371 |
11725-11727 |
: |
denotes |
: |
T6372 |
11727-11737 |
NN |
denotes |
Immunoblot |
T6369 |
11738-11746 |
NN |
denotes |
analysis |
T6373 |
11747-11749 |
IN |
denotes |
of |
T6374 |
11750-11754 |
NN |
denotes |
Acdp |
T6375 |
11755-11763 |
NN |
denotes |
proteins |
T6376 |
11764-11766 |
IN |
denotes |
in |
T6377 |
11767-11772 |
NN |
denotes |
brain |
T6378 |
11773-11779 |
NN |
denotes |
tissue |
T6379 |
11780-11788 |
NNS |
denotes |
extracts |
T6380 |
11788-11789 |
. |
denotes |
. |
T6381 |
11789-11879 |
sentence |
denotes |
Immunoblotting were carried out using a Western blotting detection system (ECL) (PIERCE). |
T6382 |
11790-11804 |
NN |
denotes |
Immunoblotting |
T6384 |
11805-11809 |
VBD |
denotes |
were |
T6383 |
11810-11817 |
VBN |
denotes |
carried |
T6385 |
11818-11821 |
RP |
denotes |
out |
T6386 |
11822-11827 |
VBG |
denotes |
using |
T6387 |
11828-11829 |
DT |
denotes |
a |
T6389 |
11830-11837 |
NNP |
denotes |
Western |
T6390 |
11838-11846 |
NN |
denotes |
blotting |
T6391 |
11847-11856 |
NN |
denotes |
detection |
T6388 |
11857-11863 |
NN |
denotes |
system |
T6392 |
11864-11865 |
-LRB- |
denotes |
( |
T6393 |
11865-11868 |
NN |
denotes |
ECL |
T6394 |
11868-11869 |
-RRB- |
denotes |
) |
T6395 |
11870-11871 |
-LRB- |
denotes |
( |
T6396 |
11871-11877 |
NN |
denotes |
PIERCE |
T6397 |
11877-11878 |
-RRB- |
denotes |
) |
T6398 |
11878-11879 |
. |
denotes |
. |
T6399 |
11879-11940 |
sentence |
denotes |
Lane 1, probed with antibody generated by conserved peptide. |
T6400 |
11880-11884 |
NN |
denotes |
Lane |
T6402 |
11885-11886 |
CD |
denotes |
1 |
T6403 |
11886-11888 |
, |
denotes |
, |
T6401 |
11888-11894 |
VBN |
denotes |
probed |
T6404 |
11895-11899 |
IN |
denotes |
with |
T6405 |
11900-11908 |
NN |
denotes |
antibody |
T6406 |
11909-11918 |
VBN |
denotes |
generated |
T6407 |
11919-11921 |
IN |
denotes |
by |
T6408 |
11922-11931 |
JJ |
denotes |
conserved |
T6409 |
11932-11939 |
NN |
denotes |
peptide |
T6410 |
11939-11940 |
. |
denotes |
. |
T6411 |
11940-12052 |
sentence |
denotes |
From top to bottom, each band corresponding to Acdp1 (115 kD), Acdp2 (100 kD), Acdp4 (90 kD) and Acdp3 (80 kD). |
T6412 |
11941-11945 |
IN |
denotes |
From |
T6414 |
11946-11949 |
NN |
denotes |
top |
T6415 |
11950-11952 |
IN |
denotes |
to |
T6416 |
11953-11959 |
NN |
denotes |
bottom |
T6417 |
11959-11961 |
, |
denotes |
, |
T6418 |
11961-11965 |
DT |
denotes |
each |
T6413 |
11966-11970 |
NN |
denotes |
band |
T6419 |
11971-11984 |
VBG |
denotes |
corresponding |
T6420 |
11985-11987 |
IN |
denotes |
to |
T6421 |
11988-11993 |
NN |
denotes |
Acdp1 |
T6422 |
11994-11995 |
-LRB- |
denotes |
( |
T6424 |
11995-11998 |
CD |
denotes |
115 |
T6423 |
11999-12001 |
NN |
denotes |
kD |
T6425 |
12001-12002 |
-RRB- |
denotes |
) |
T6426 |
12002-12004 |
, |
denotes |
, |
T6427 |
12004-12009 |
NN |
denotes |
Acdp2 |
T6428 |
12010-12011 |
-LRB- |
denotes |
( |
T6430 |
12011-12014 |
CD |
denotes |
100 |
T6429 |
12015-12017 |
NN |
denotes |
kD |
T6431 |
12017-12018 |
-RRB- |
denotes |
) |
T6432 |
12018-12020 |
, |
denotes |
, |
T6433 |
12020-12025 |
NN |
denotes |
Acdp4 |
T6434 |
12026-12027 |
-LRB- |
denotes |
( |
T6436 |
12027-12029 |
CD |
denotes |
90 |
T6435 |
12030-12032 |
NN |
denotes |
kD |
T6437 |
12032-12033 |
-RRB- |
denotes |
) |
T6438 |
12034-12037 |
CC |
denotes |
and |
T6439 |
12038-12043 |
NN |
denotes |
Acdp3 |
T6440 |
12044-12045 |
-LRB- |
denotes |
( |
T6442 |
12045-12047 |
CD |
denotes |
80 |
T6441 |
12048-12050 |
NN |
denotes |
kD |
T6443 |
12050-12051 |
-RRB- |
denotes |
) |
T6444 |
12051-12052 |
. |
denotes |
. |
T6445 |
12052-12162 |
sentence |
denotes |
Lane 2 and 3, probed with the Acdp1 antibodies generated by N-terminal and C-terminal peptides, respectively. |
T6446 |
12053-12057 |
NN |
denotes |
Lane |
T6447 |
12058-12059 |
CD |
denotes |
2 |
T6449 |
12060-12063 |
CC |
denotes |
and |
T6450 |
12064-12065 |
CD |
denotes |
3 |
T6451 |
12065-12067 |
, |
denotes |
, |
T6448 |
12067-12073 |
VBN |
denotes |
probed |
T6452 |
12074-12078 |
IN |
denotes |
with |
T6453 |
12079-12082 |
DT |
denotes |
the |
T6455 |
12083-12088 |
NN |
denotes |
Acdp1 |
T6454 |
12089-12099 |
NNS |
denotes |
antibodies |
T6456 |
12100-12109 |
VBN |
denotes |
generated |
T6457 |
12110-12112 |
IN |
denotes |
by |
T6458 |
12113-12114 |
NN |
denotes |
N |
T6460 |
12114-12115 |
HYPH |
denotes |
- |
T6459 |
12115-12123 |
JJ |
denotes |
terminal |
T6462 |
12124-12127 |
CC |
denotes |
and |
T6463 |
12128-12129 |
NN |
denotes |
C |
T6465 |
12129-12130 |
HYPH |
denotes |
- |
T6464 |
12130-12138 |
JJ |
denotes |
terminal |
T6461 |
12139-12147 |
NNS |
denotes |
peptides |
T6466 |
12147-12149 |
, |
denotes |
, |
T6467 |
12149-12161 |
RB |
denotes |
respectively |
T6468 |
12161-12162 |
. |
denotes |
. |
T6469 |
12162-12231 |
sentence |
denotes |
Fig. 6B: Immunoblot analysis of Acdp1 in HEK293, 3T3 and PC12 cells. |
T6470 |
12163-12167 |
NN |
denotes |
Fig. |
T6472 |
12168-12170 |
CD |
denotes |
6B |
T6473 |
12170-12172 |
: |
denotes |
: |
T6474 |
12172-12182 |
NN |
denotes |
Immunoblot |
T6471 |
12183-12191 |
NN |
denotes |
analysis |
T6475 |
12192-12194 |
IN |
denotes |
of |
T6476 |
12195-12200 |
NN |
denotes |
Acdp1 |
T6477 |
12201-12203 |
IN |
denotes |
in |
T6478 |
12204-12210 |
NN |
denotes |
HEK293 |
T6480 |
12210-12212 |
, |
denotes |
, |
T6481 |
12212-12215 |
NN |
denotes |
3T3 |
T6482 |
12216-12219 |
CC |
denotes |
and |
T6483 |
12220-12224 |
NN |
denotes |
PC12 |
T6479 |
12225-12230 |
NNS |
denotes |
cells |
T6484 |
12230-12231 |
. |
denotes |
. |
T6485 |
12231-12305 |
sentence |
denotes |
The blots were probed with the antibody against the C-terminus of Acdp-1. |
T6486 |
12232-12235 |
DT |
denotes |
The |
T6487 |
12236-12241 |
NNS |
denotes |
blots |
T6489 |
12242-12246 |
VBD |
denotes |
were |
T6488 |
12247-12253 |
VBN |
denotes |
probed |
T6490 |
12254-12258 |
IN |
denotes |
with |
T6491 |
12259-12262 |
DT |
denotes |
the |
T6492 |
12263-12271 |
NN |
denotes |
antibody |
T6493 |
12272-12279 |
IN |
denotes |
against |
T6494 |
12280-12283 |
DT |
denotes |
the |
T6496 |
12284-12285 |
NN |
denotes |
C |
T6497 |
12285-12286 |
HYPH |
denotes |
- |
T6495 |
12286-12294 |
NN |
denotes |
terminus |
T6498 |
12295-12297 |
IN |
denotes |
of |
T6499 |
12298-12302 |
NN |
denotes |
Acdp |
T6500 |
12302-12303 |
HYPH |
denotes |
- |
T6501 |
12303-12304 |
CD |
denotes |
1 |
T6502 |
12304-12305 |
. |
denotes |
. |
T6503 |
12305-12343 |
sentence |
denotes |
Lane 1, 10 μg of HEK293 cell lysates. |
T6504 |
12306-12310 |
NN |
denotes |
Lane |
T6506 |
12311-12312 |
CD |
denotes |
1 |
T6507 |
12312-12314 |
, |
denotes |
, |
T6508 |
12314-12316 |
CD |
denotes |
10 |
T6505 |
12317-12319 |
NNS |
denotes |
μg |
T6509 |
12320-12322 |
IN |
denotes |
of |
T6510 |
12323-12329 |
NN |
denotes |
HEK293 |
T6512 |
12330-12334 |
NN |
denotes |
cell |
T6511 |
12335-12342 |
NNS |
denotes |
lysates |
T6513 |
12342-12343 |
. |
denotes |
. |
T6514 |
12343-12394 |
sentence |
denotes |
Lane 2 and 3, 100 μg of 3T3 and PC12 cell lysates. |
T6515 |
12344-12348 |
NN |
denotes |
Lane |
T6516 |
12349-12350 |
CD |
denotes |
2 |
T6518 |
12351-12354 |
CC |
denotes |
and |
T6519 |
12355-12356 |
CD |
denotes |
3 |
T6520 |
12356-12358 |
, |
denotes |
, |
T6521 |
12358-12361 |
CD |
denotes |
100 |
T6517 |
12362-12364 |
NNS |
denotes |
μg |
T6522 |
12365-12367 |
IN |
denotes |
of |
T6523 |
12368-12371 |
NN |
denotes |
3T3 |
T6525 |
12372-12375 |
CC |
denotes |
and |
T6526 |
12376-12380 |
NN |
denotes |
PC12 |
T6527 |
12381-12385 |
NN |
denotes |
cell |
T6524 |
12386-12393 |
NNS |
denotes |
lysates |
T6528 |
12393-12394 |
. |
denotes |
. |
T6553 |
12405-12416 |
JJ |
denotes |
Subcellular |
T6554 |
12417-12429 |
NN |
denotes |
localization |
T6555 |
12430-12432 |
IN |
denotes |
of |
T6556 |
12433-12438 |
NN |
denotes |
Acdp1 |
T6557 |
12439-12441 |
IN |
denotes |
in |
T6558 |
12442-12453 |
NN |
denotes |
hippocampus |
T6559 |
12454-12461 |
NNS |
denotes |
neurons |
T6560 |
12461-12462 |
. |
denotes |
. |
T6561 |
12462-12550 |
sentence |
denotes |
A series of confocal images from a cultured neuron stained with an anti-Acdp1 antibody. |
T6562 |
12463-12464 |
DT |
denotes |
A |
T6563 |
12465-12471 |
NN |
denotes |
series |
T6564 |
12472-12474 |
IN |
denotes |
of |
T6565 |
12475-12483 |
JJ |
denotes |
confocal |
T6566 |
12484-12490 |
NNS |
denotes |
images |
T6567 |
12491-12495 |
IN |
denotes |
from |
T6568 |
12496-12497 |
DT |
denotes |
a |
T6570 |
12498-12506 |
VBN |
denotes |
cultured |
T6569 |
12507-12513 |
NN |
denotes |
neuron |
T6571 |
12514-12521 |
VBN |
denotes |
stained |
T6572 |
12522-12526 |
IN |
denotes |
with |
T6573 |
12527-12529 |
DT |
denotes |
an |
T6575 |
12530-12540 |
JJ |
denotes |
anti-Acdp1 |
T6574 |
12541-12549 |
NN |
denotes |
antibody |
T6576 |
12549-12550 |
. |
denotes |
. |
T6577 |
12550-12661 |
sentence |
denotes |
The step of each imaging section is 0.5 μm, from the surface of the neuron (0 μm) to the middle plan (4.5 μm). |
T6578 |
12551-12554 |
DT |
denotes |
The |
T6579 |
12555-12559 |
NN |
denotes |
step |
T6581 |
12560-12562 |
IN |
denotes |
of |
T6582 |
12563-12567 |
DT |
denotes |
each |
T6584 |
12568-12575 |
NN |
denotes |
imaging |
T6583 |
12576-12583 |
NN |
denotes |
section |
T6580 |
12584-12586 |
VBZ |
denotes |
is |
T6585 |
12587-12590 |
CD |
denotes |
0.5 |
T6586 |
12591-12593 |
NNS |
denotes |
μm |
T6587 |
12593-12595 |
, |
denotes |
, |
T6588 |
12595-12599 |
IN |
denotes |
from |
T6589 |
12600-12603 |
DT |
denotes |
the |
T6590 |
12604-12611 |
NN |
denotes |
surface |
T6591 |
12612-12614 |
IN |
denotes |
of |
T6592 |
12615-12618 |
DT |
denotes |
the |
T6593 |
12619-12625 |
NN |
denotes |
neuron |
T6594 |
12626-12627 |
-LRB- |
denotes |
( |
T6596 |
12627-12628 |
CD |
denotes |
0 |
T6595 |
12629-12631 |
NNS |
denotes |
μm |
T6597 |
12631-12632 |
-RRB- |
denotes |
) |
T6598 |
12633-12635 |
IN |
denotes |
to |
T6599 |
12636-12639 |
DT |
denotes |
the |
T6601 |
12640-12646 |
JJ |
denotes |
middle |
T6600 |
12647-12651 |
NN |
denotes |
plan |
T6602 |
12652-12653 |
-LRB- |
denotes |
( |
T6604 |
12653-12656 |
CD |
denotes |
4.5 |
T6603 |
12657-12659 |
NNS |
denotes |
μm |
T6605 |
12659-12660 |
-RRB- |
denotes |
) |
T6606 |
12660-12661 |
. |
denotes |
. |
T3529 |
12674-12682 |
IN |
denotes |
Although |
T3531 |
12683-12686 |
DT |
denotes |
the |
T3533 |
12687-12692 |
JJ |
denotes |
exact |
T3532 |
12693-12702 |
NNS |
denotes |
functions |
T3534 |
12703-12705 |
IN |
denotes |
of |
T3535 |
12706-12709 |
DT |
denotes |
the |
T3537 |
12710-12714 |
NN |
denotes |
ACDP |
T3538 |
12715-12719 |
NN |
denotes |
gene |
T3536 |
12720-12726 |
NN |
denotes |
family |
T3539 |
12727-12730 |
VBP |
denotes |
are |
T3540 |
12731-12734 |
RB |
denotes |
not |
T3541 |
12735-12738 |
RB |
denotes |
yet |
T3530 |
12739-12749 |
VBN |
denotes |
elucidated |
T3543 |
12749-12751 |
, |
denotes |
, |
T3544 |
12751-12758 |
JJ |
denotes |
several |
T3545 |
12759-12764 |
NNS |
denotes |
lines |
T3546 |
12765-12767 |
IN |
denotes |
of |
T3547 |
12768-12776 |
NN |
denotes |
evidence |
T3542 |
12777-12784 |
VBP |
denotes |
suggest |
T3548 |
12785-12789 |
IN |
denotes |
that |
T3550 |
12790-12794 |
NN |
denotes |
ACDP |
T3551 |
12795-12800 |
NNS |
denotes |
genes |
T3552 |
12801-12804 |
MD |
denotes |
may |
T3549 |
12805-12809 |
VB |
denotes |
play |
T3553 |
12810-12812 |
DT |
denotes |
an |
T3555 |
12813-12822 |
JJ |
denotes |
important |
T3554 |
12823-12827 |
NN |
denotes |
role |
T3556 |
12828-12830 |
IN |
denotes |
in |
T3557 |
12831-12841 |
JJ |
denotes |
biological |
T3558 |
12842-12851 |
NNS |
denotes |
processes |
T3559 |
12851-12852 |
. |
denotes |
. |
T3560 |
12852-13100 |
sentence |
denotes |
First, these genes are evolutionarily conserved in many phylogenetically divergent species; Second, multiple genes are present in a species; Third, these genes are ubiquitously expressed throughout development and adult tissues (unpublished data). |
T3561 |
12853-12858 |
RB |
denotes |
First |
T3563 |
12858-12860 |
, |
denotes |
, |
T3564 |
12860-12865 |
DT |
denotes |
these |
T3565 |
12866-12871 |
NNS |
denotes |
genes |
T3566 |
12872-12875 |
VBP |
denotes |
are |
T3567 |
12876-12890 |
RB |
denotes |
evolutionarily |
T3562 |
12891-12900 |
VBN |
denotes |
conserved |
T3569 |
12901-12903 |
IN |
denotes |
in |
T3570 |
12904-12908 |
JJ |
denotes |
many |
T3572 |
12909-12925 |
RB |
denotes |
phylogenetically |
T3573 |
12926-12935 |
JJ |
denotes |
divergent |
T3571 |
12936-12943 |
NNS |
denotes |
species |
T3574 |
12943-12944 |
: |
denotes |
; |
T3575 |
12945-12951 |
RB |
denotes |
Second |
T3577 |
12951-12953 |
, |
denotes |
, |
T3578 |
12953-12961 |
JJ |
denotes |
multiple |
T3579 |
12962-12967 |
NNS |
denotes |
genes |
T3576 |
12968-12971 |
VBP |
denotes |
are |
T3580 |
12972-12979 |
JJ |
denotes |
present |
T3581 |
12980-12982 |
IN |
denotes |
in |
T3582 |
12983-12984 |
DT |
denotes |
a |
T3583 |
12985-12992 |
NN |
denotes |
species |
T3584 |
12992-12993 |
: |
denotes |
; |
T3585 |
12994-12999 |
RB |
denotes |
Third |
T3586 |
12999-13001 |
, |
denotes |
, |
T3587 |
13001-13006 |
DT |
denotes |
these |
T3588 |
13007-13012 |
NNS |
denotes |
genes |
T3589 |
13013-13016 |
VBP |
denotes |
are |
T3590 |
13017-13029 |
RB |
denotes |
ubiquitously |
T3568 |
13030-13039 |
VBN |
denotes |
expressed |
T3591 |
13040-13050 |
IN |
denotes |
throughout |
T3592 |
13051-13062 |
NN |
denotes |
development |
T3594 |
13063-13066 |
CC |
denotes |
and |
T3595 |
13067-13072 |
JJ |
denotes |
adult |
T3593 |
13073-13080 |
NNS |
denotes |
tissues |
T3596 |
13081-13082 |
-LRB- |
denotes |
( |
T3598 |
13082-13093 |
JJ |
denotes |
unpublished |
T3597 |
13094-13098 |
NNS |
denotes |
data |
T3599 |
13098-13099 |
-RRB- |
denotes |
) |
T3600 |
13099-13100 |
. |
denotes |
. |
T3601 |
13100-13256 |
sentence |
denotes |
The cloning and characterization of the mouse Acdp gene family are a very important step towards the elucidation of the functions of this multigene family. |
T3602 |
13101-13104 |
DT |
denotes |
The |
T3603 |
13105-13112 |
NN |
denotes |
cloning |
T3605 |
13113-13116 |
CC |
denotes |
and |
T3606 |
13117-13133 |
NN |
denotes |
characterization |
T3607 |
13134-13136 |
IN |
denotes |
of |
T3608 |
13137-13140 |
DT |
denotes |
the |
T3610 |
13141-13146 |
NN |
denotes |
mouse |
T3611 |
13147-13151 |
NN |
denotes |
Acdp |
T3612 |
13152-13156 |
NN |
denotes |
gene |
T3609 |
13157-13163 |
NN |
denotes |
family |
T3604 |
13164-13167 |
VBP |
denotes |
are |
T3613 |
13168-13169 |
DT |
denotes |
a |
T3615 |
13170-13174 |
RB |
denotes |
very |
T3616 |
13175-13184 |
JJ |
denotes |
important |
T3614 |
13185-13189 |
NN |
denotes |
step |
T3617 |
13190-13197 |
IN |
denotes |
towards |
T3618 |
13198-13201 |
DT |
denotes |
the |
T3619 |
13202-13213 |
NN |
denotes |
elucidation |
T3620 |
13214-13216 |
IN |
denotes |
of |
T3621 |
13217-13220 |
DT |
denotes |
the |
T3622 |
13221-13230 |
NNS |
denotes |
functions |
T3623 |
13231-13233 |
IN |
denotes |
of |
T3624 |
13234-13238 |
DT |
denotes |
this |
T3626 |
13239-13248 |
JJ |
denotes |
multigene |
T3625 |
13249-13255 |
NN |
denotes |
family |
T3627 |
13255-13256 |
. |
denotes |
. |
T3628 |
13256-13398 |
sentence |
denotes |
Sequence homology analyses revealed that Acdp proteins shared very strong AA homologies to the bacteria CorC protein and yeast Amip3 protein. |
T3629 |
13257-13265 |
NN |
denotes |
Sequence |
T3631 |
13266-13274 |
NN |
denotes |
homology |
T3630 |
13275-13283 |
NNS |
denotes |
analyses |
T3632 |
13284-13292 |
VBD |
denotes |
revealed |
T3633 |
13293-13297 |
IN |
denotes |
that |
T3635 |
13298-13302 |
NN |
denotes |
Acdp |
T3636 |
13303-13311 |
NN |
denotes |
proteins |
T3634 |
13312-13318 |
VBD |
denotes |
shared |
T3637 |
13319-13323 |
RB |
denotes |
very |
T3638 |
13324-13330 |
JJ |
denotes |
strong |
T3640 |
13331-13333 |
NN |
denotes |
AA |
T3639 |
13334-13344 |
NNS |
denotes |
homologies |
T3641 |
13345-13347 |
IN |
denotes |
to |
T3642 |
13348-13351 |
DT |
denotes |
the |
T3644 |
13352-13360 |
NNS |
denotes |
bacteria |
T3645 |
13361-13365 |
NN |
denotes |
CorC |
T3643 |
13366-13373 |
NN |
denotes |
protein |
T3646 |
13374-13377 |
CC |
denotes |
and |
T3647 |
13378-13383 |
NN |
denotes |
yeast |
T3649 |
13384-13389 |
NN |
denotes |
Amip3 |
T3648 |
13390-13397 |
NN |
denotes |
protein |
T3650 |
13397-13398 |
. |
denotes |
. |
T3651 |
13398-13502 |
sentence |
denotes |
CorA, B, C and D belong to a protein family involved in both influx and efflux of magnesium and cobalt. |
T3652 |
13399-13403 |
NN |
denotes |
CorA |
T3654 |
13403-13405 |
, |
denotes |
, |
T3655 |
13405-13406 |
NN |
denotes |
B |
T3656 |
13406-13408 |
, |
denotes |
, |
T3657 |
13408-13409 |
NN |
denotes |
C |
T3658 |
13410-13413 |
CC |
denotes |
and |
T3659 |
13414-13415 |
NN |
denotes |
D |
T3653 |
13416-13422 |
VBP |
denotes |
belong |
T3660 |
13423-13425 |
IN |
denotes |
to |
T3661 |
13426-13427 |
DT |
denotes |
a |
T3663 |
13428-13435 |
NN |
denotes |
protein |
T3662 |
13436-13442 |
NN |
denotes |
family |
T3664 |
13443-13451 |
VBN |
denotes |
involved |
T3665 |
13452-13454 |
IN |
denotes |
in |
T3666 |
13455-13459 |
CC |
denotes |
both |
T3667 |
13460-13466 |
NN |
denotes |
influx |
T3668 |
13467-13470 |
CC |
denotes |
and |
T3669 |
13471-13477 |
NN |
denotes |
efflux |
T3670 |
13478-13480 |
IN |
denotes |
of |
T3671 |
13481-13490 |
NN |
denotes |
magnesium |
T3672 |
13491-13494 |
CC |
denotes |
and |
T3673 |
13495-13501 |
NN |
denotes |
cobalt |
T3674 |
13501-13502 |
. |
denotes |
. |
T3675 |
13502-13580 |
sentence |
denotes |
It has been shown that CorA mutants confer resistance to cobalt toxicity [9]. |
T3676 |
13503-13505 |
PRP |
denotes |
It |
T3678 |
13506-13509 |
VBZ |
denotes |
has |
T3679 |
13510-13514 |
VBN |
denotes |
been |
T3677 |
13515-13520 |
VBN |
denotes |
shown |
T3680 |
13521-13525 |
IN |
denotes |
that |
T3682 |
13526-13530 |
NN |
denotes |
CorA |
T3683 |
13531-13538 |
NNS |
denotes |
mutants |
T3681 |
13539-13545 |
VBP |
denotes |
confer |
T3684 |
13546-13556 |
NN |
denotes |
resistance |
T3685 |
13557-13559 |
IN |
denotes |
to |
T3686 |
13560-13566 |
NN |
denotes |
cobalt |
T3687 |
13567-13575 |
NN |
denotes |
toxicity |
T3688 |
13576-13577 |
-LRB- |
denotes |
[ |
T3689 |
13577-13578 |
CD |
denotes |
9 |
T3690 |
13578-13579 |
-RRB- |
denotes |
] |
T3691 |
13579-13580 |
. |
denotes |
. |
T3692 |
13580-13694 |
sentence |
denotes |
Amip3 appears to be a homologous to CorC protein which is involved in efflux of magnesium and cobalt in bacteria. |
T3693 |
13581-13586 |
NN |
denotes |
Amip3 |
T3694 |
13587-13594 |
VBZ |
denotes |
appears |
T3695 |
13595-13597 |
TO |
denotes |
to |
T3696 |
13598-13600 |
VB |
denotes |
be |
T3697 |
13601-13602 |
DT |
denotes |
a |
T3698 |
13603-13613 |
JJ |
denotes |
homologous |
T3699 |
13614-13616 |
IN |
denotes |
to |
T3700 |
13617-13621 |
NN |
denotes |
CorC |
T3701 |
13622-13629 |
NN |
denotes |
protein |
T3702 |
13630-13635 |
WDT |
denotes |
which |
T3704 |
13636-13638 |
VBZ |
denotes |
is |
T3703 |
13639-13647 |
VBN |
denotes |
involved |
T3705 |
13648-13650 |
IN |
denotes |
in |
T3706 |
13651-13657 |
NN |
denotes |
efflux |
T3707 |
13658-13660 |
IN |
denotes |
of |
T3708 |
13661-13670 |
NN |
denotes |
magnesium |
T3709 |
13671-13674 |
CC |
denotes |
and |
T3710 |
13675-13681 |
NN |
denotes |
cobalt |
T3711 |
13682-13684 |
IN |
denotes |
in |
T3712 |
13685-13693 |
NNS |
denotes |
bacteria |
T3713 |
13693-13694 |
. |
denotes |
. |
T3714 |
13694-13745 |
sentence |
denotes |
Amip3 mutants confer resistant to copper toxicity. |
T3715 |
13695-13700 |
NN |
denotes |
Amip3 |
T3716 |
13701-13708 |
NNS |
denotes |
mutants |
T3717 |
13709-13715 |
VBP |
denotes |
confer |
T3718 |
13716-13725 |
NN |
denotes |
resistant |
T3719 |
13726-13728 |
IN |
denotes |
to |
T3720 |
13729-13735 |
NN |
denotes |
copper |
T3721 |
13736-13744 |
NN |
denotes |
toxicity |
T3722 |
13744-13745 |
. |
denotes |
. |
T3723 |
13745-13907 |
sentence |
denotes |
Acdp proteins also possess the domains that are found in bacteria CorC and yeast Amip3 proteins, such as the CBS domains, DUF21 domain and transmembrane domains. |
T3724 |
13746-13750 |
NN |
denotes |
Acdp |
T3726 |
13751-13759 |
NN |
denotes |
proteins |
T3727 |
13760-13764 |
RB |
denotes |
also |
T3725 |
13765-13772 |
VBP |
denotes |
possess |
T3728 |
13773-13776 |
DT |
denotes |
the |
T3729 |
13777-13784 |
NNS |
denotes |
domains |
T3730 |
13785-13789 |
WDT |
denotes |
that |
T3732 |
13790-13793 |
VBP |
denotes |
are |
T3731 |
13794-13799 |
VBN |
denotes |
found |
T3733 |
13800-13802 |
IN |
denotes |
in |
T3734 |
13803-13811 |
NNS |
denotes |
bacteria |
T3735 |
13812-13816 |
NN |
denotes |
CorC |
T3737 |
13817-13820 |
CC |
denotes |
and |
T3738 |
13821-13826 |
NN |
denotes |
yeast |
T3739 |
13827-13832 |
NN |
denotes |
Amip3 |
T3736 |
13833-13841 |
NN |
denotes |
proteins |
T3740 |
13841-13843 |
, |
denotes |
, |
T3741 |
13843-13847 |
JJ |
denotes |
such |
T3742 |
13848-13850 |
IN |
denotes |
as |
T3743 |
13851-13854 |
DT |
denotes |
the |
T3745 |
13855-13858 |
NN |
denotes |
CBS |
T3744 |
13859-13866 |
NNS |
denotes |
domains |
T3746 |
13866-13868 |
, |
denotes |
, |
T3747 |
13868-13873 |
NN |
denotes |
DUF21 |
T3748 |
13874-13880 |
NN |
denotes |
domain |
T3749 |
13881-13884 |
CC |
denotes |
and |
T3750 |
13885-13898 |
NN |
denotes |
transmembrane |
T3751 |
13899-13906 |
NNS |
denotes |
domains |
T3752 |
13906-13907 |
. |
denotes |
. |
T3753 |
13907-14051 |
sentence |
denotes |
In addition, a cNMP-binding domain was found in all Acdp proteins, which is usually present in ion channels and cNMP-dependent kinases [10-13]. |
T3754 |
13908-13910 |
IN |
denotes |
In |
T3756 |
13911-13919 |
NN |
denotes |
addition |
T3757 |
13919-13921 |
, |
denotes |
, |
T3758 |
13921-13922 |
DT |
denotes |
a |
T3760 |
13923-13927 |
NN |
denotes |
cNMP |
T3762 |
13927-13928 |
HYPH |
denotes |
- |
T3761 |
13928-13935 |
VBG |
denotes |
binding |
T3759 |
13936-13942 |
NN |
denotes |
domain |
T3763 |
13943-13946 |
VBD |
denotes |
was |
T3755 |
13947-13952 |
VBN |
denotes |
found |
T3764 |
13953-13955 |
IN |
denotes |
in |
T3765 |
13956-13959 |
DT |
denotes |
all |
T3767 |
13960-13964 |
NN |
denotes |
Acdp |
T3766 |
13965-13973 |
NN |
denotes |
proteins |
T3768 |
13973-13975 |
, |
denotes |
, |
T3769 |
13975-13980 |
WDT |
denotes |
which |
T3770 |
13981-13983 |
VBZ |
denotes |
is |
T3771 |
13984-13991 |
RB |
denotes |
usually |
T3772 |
13992-13999 |
JJ |
denotes |
present |
T3773 |
14000-14002 |
IN |
denotes |
in |
T3774 |
14003-14006 |
NN |
denotes |
ion |
T3775 |
14007-14015 |
NNS |
denotes |
channels |
T3776 |
14016-14019 |
CC |
denotes |
and |
T3777 |
14020-14024 |
NN |
denotes |
cNMP |
T3779 |
14024-14025 |
HYPH |
denotes |
- |
T3780 |
14025-14034 |
JJ |
denotes |
dependent |
T3778 |
14035-14042 |
NNS |
denotes |
kinases |
T3781 |
14043-14044 |
-LRB- |
denotes |
[ |
T3782 |
14044-14046 |
CD |
denotes |
10 |
T3783 |
14046-14047 |
SYM |
denotes |
- |
T3784 |
14047-14049 |
CD |
denotes |
13 |
T3785 |
14049-14050 |
-RRB- |
denotes |
] |
T3786 |
14050-14051 |
. |
denotes |
. |
T3787 |
14051-14203 |
sentence |
denotes |
Using antibody produced by Acdp1 C-terminal peptide, we have shown that Acdp1 is predominantly localized on the plasma membrane in hippocampus neurons. |
T3788 |
14052-14057 |
VBG |
denotes |
Using |
T3790 |
14058-14066 |
NN |
denotes |
antibody |
T3791 |
14067-14075 |
VBN |
denotes |
produced |
T3792 |
14076-14078 |
IN |
denotes |
by |
T3793 |
14079-14084 |
NN |
denotes |
Acdp1 |
T3795 |
14085-14086 |
NN |
denotes |
C |
T3797 |
14086-14087 |
HYPH |
denotes |
- |
T3796 |
14087-14095 |
JJ |
denotes |
terminal |
T3794 |
14096-14103 |
NN |
denotes |
peptide |
T3798 |
14103-14105 |
, |
denotes |
, |
T3799 |
14105-14107 |
PRP |
denotes |
we |
T3800 |
14108-14112 |
VBP |
denotes |
have |
T3789 |
14113-14118 |
VBN |
denotes |
shown |
T3801 |
14119-14123 |
IN |
denotes |
that |
T3803 |
14124-14129 |
NN |
denotes |
Acdp1 |
T3804 |
14130-14132 |
VBZ |
denotes |
is |
T3805 |
14133-14146 |
RB |
denotes |
predominantly |
T3802 |
14147-14156 |
VBN |
denotes |
localized |
T3806 |
14157-14159 |
IN |
denotes |
on |
T3807 |
14160-14163 |
DT |
denotes |
the |
T3809 |
14164-14170 |
NN |
denotes |
plasma |
T3808 |
14171-14179 |
NN |
denotes |
membrane |
T3810 |
14180-14182 |
IN |
denotes |
in |
T3811 |
14183-14194 |
NN |
denotes |
hippocampus |
T3812 |
14195-14202 |
NNS |
denotes |
neurons |
T3813 |
14202-14203 |
. |
denotes |
. |
T3814 |
14203-14317 |
sentence |
denotes |
In our previous study, we found human ACDP proteins are predominantly localized in the nucleus in HeLa cells [1]. |
T3815 |
14204-14206 |
IN |
denotes |
In |
T3817 |
14207-14210 |
PRP$ |
denotes |
our |
T3819 |
14211-14219 |
JJ |
denotes |
previous |
T3818 |
14220-14225 |
NN |
denotes |
study |
T3820 |
14225-14227 |
, |
denotes |
, |
T3821 |
14227-14229 |
PRP |
denotes |
we |
T3816 |
14230-14235 |
VBD |
denotes |
found |
T3822 |
14236-14241 |
JJ |
denotes |
human |
T3824 |
14242-14246 |
NN |
denotes |
ACDP |
T3823 |
14247-14255 |
NN |
denotes |
proteins |
T3826 |
14256-14259 |
VBP |
denotes |
are |
T3827 |
14260-14273 |
RB |
denotes |
predominantly |
T3825 |
14274-14283 |
VBN |
denotes |
localized |
T3828 |
14284-14286 |
IN |
denotes |
in |
T3829 |
14287-14290 |
DT |
denotes |
the |
T3830 |
14291-14298 |
NN |
denotes |
nucleus |
T3831 |
14299-14301 |
IN |
denotes |
in |
T3832 |
14302-14306 |
NN |
denotes |
HeLa |
T3833 |
14307-14312 |
NNS |
denotes |
cells |
T3834 |
14313-14314 |
-LRB- |
denotes |
[ |
T3835 |
14314-14315 |
CD |
denotes |
1 |
T3836 |
14315-14316 |
-RRB- |
denotes |
] |
T3837 |
14316-14317 |
. |
denotes |
. |
T3838 |
14317-14505 |
sentence |
denotes |
The discrepancy for Acdp localization in neuronal cells could be caused by non-specificity for previous antibody which was produced by the recombinant ACD domain, or different cells used. |
T3839 |
14318-14321 |
DT |
denotes |
The |
T3840 |
14322-14333 |
NN |
denotes |
discrepancy |
T3842 |
14334-14337 |
IN |
denotes |
for |
T3843 |
14338-14342 |
NN |
denotes |
Acdp |
T3844 |
14343-14355 |
NN |
denotes |
localization |
T3845 |
14356-14358 |
IN |
denotes |
in |
T3846 |
14359-14367 |
JJ |
denotes |
neuronal |
T3847 |
14368-14373 |
NNS |
denotes |
cells |
T3848 |
14374-14379 |
MD |
denotes |
could |
T3849 |
14380-14382 |
VB |
denotes |
be |
T3841 |
14383-14389 |
VBN |
denotes |
caused |
T3850 |
14390-14392 |
IN |
denotes |
by |
T3851 |
14393-14408 |
NN |
denotes |
non-specificity |
T3852 |
14409-14412 |
IN |
denotes |
for |
T3853 |
14413-14421 |
JJ |
denotes |
previous |
T3854 |
14422-14430 |
NN |
denotes |
antibody |
T3855 |
14431-14436 |
WDT |
denotes |
which |
T3857 |
14437-14440 |
VBD |
denotes |
was |
T3856 |
14441-14449 |
VBN |
denotes |
produced |
T3858 |
14450-14452 |
IN |
denotes |
by |
T3859 |
14453-14456 |
DT |
denotes |
the |
T3861 |
14457-14468 |
JJ |
denotes |
recombinant |
T3862 |
14469-14472 |
NN |
denotes |
ACD |
T3860 |
14473-14479 |
NN |
denotes |
domain |
T3863 |
14479-14481 |
, |
denotes |
, |
T3864 |
14481-14483 |
CC |
denotes |
or |
T3865 |
14484-14493 |
JJ |
denotes |
different |
T3866 |
14494-14499 |
NNS |
denotes |
cells |
T3867 |
14500-14504 |
VBN |
denotes |
used |
T3868 |
14504-14505 |
. |
denotes |
. |
T3869 |
14505-14693 |
sentence |
denotes |
In current study, the Acdp1 C-terminus antibody only recognizes Acdp1 in brain tissue extracts as well as in HEK293, 3T3 and PC12 cell lysates, suggesting the specificity of the antibody. |
T3870 |
14506-14508 |
IN |
denotes |
In |
T3872 |
14509-14516 |
JJ |
denotes |
current |
T3873 |
14517-14522 |
NN |
denotes |
study |
T3874 |
14522-14524 |
, |
denotes |
, |
T3875 |
14524-14527 |
DT |
denotes |
the |
T3877 |
14528-14533 |
NN |
denotes |
Acdp1 |
T3878 |
14534-14535 |
NN |
denotes |
C |
T3880 |
14535-14536 |
HYPH |
denotes |
- |
T3879 |
14536-14544 |
NN |
denotes |
terminus |
T3876 |
14545-14553 |
NN |
denotes |
antibody |
T3881 |
14554-14558 |
RB |
denotes |
only |
T3871 |
14559-14569 |
VBZ |
denotes |
recognizes |
T3882 |
14570-14575 |
NN |
denotes |
Acdp1 |
T3883 |
14576-14578 |
IN |
denotes |
in |
T3884 |
14579-14584 |
NN |
denotes |
brain |
T3885 |
14585-14591 |
NN |
denotes |
tissue |
T3886 |
14592-14600 |
NNS |
denotes |
extracts |
T3887 |
14601-14603 |
RB |
denotes |
as |
T3889 |
14604-14608 |
RB |
denotes |
well |
T3888 |
14609-14611 |
IN |
denotes |
as |
T3890 |
14612-14614 |
IN |
denotes |
in |
T3891 |
14615-14621 |
NN |
denotes |
HEK293 |
T3893 |
14621-14623 |
, |
denotes |
, |
T3894 |
14623-14626 |
NN |
denotes |
3T3 |
T3895 |
14627-14630 |
CC |
denotes |
and |
T3896 |
14631-14635 |
NN |
denotes |
PC12 |
T3897 |
14636-14640 |
NN |
denotes |
cell |
T3892 |
14641-14648 |
NNS |
denotes |
lysates |
T3898 |
14648-14650 |
, |
denotes |
, |
T3899 |
14650-14660 |
VBG |
denotes |
suggesting |
T3900 |
14661-14664 |
DT |
denotes |
the |
T3901 |
14665-14676 |
NN |
denotes |
specificity |
T3902 |
14677-14679 |
IN |
denotes |
of |
T3903 |
14680-14683 |
DT |
denotes |
the |
T3904 |
14684-14692 |
NN |
denotes |
antibody |
T3905 |
14692-14693 |
. |
denotes |
. |
T3906 |
14693-14785 |
sentence |
denotes |
Our observations suggested that Acdp might be involved in ion transport in mammalian cells. |
T3907 |
14694-14697 |
PRP$ |
denotes |
Our |
T3908 |
14698-14710 |
NNS |
denotes |
observations |
T3909 |
14711-14720 |
VBD |
denotes |
suggested |
T3910 |
14721-14725 |
IN |
denotes |
that |
T3912 |
14726-14730 |
NN |
denotes |
Acdp |
T3913 |
14731-14736 |
MD |
denotes |
might |
T3914 |
14737-14739 |
VB |
denotes |
be |
T3911 |
14740-14748 |
VBN |
denotes |
involved |
T3915 |
14749-14751 |
IN |
denotes |
in |
T3916 |
14752-14755 |
NN |
denotes |
ion |
T3917 |
14756-14765 |
NN |
denotes |
transport |
T3918 |
14766-14768 |
IN |
denotes |
in |
T3919 |
14769-14778 |
JJ |
denotes |
mammalian |
T3920 |
14779-14784 |
NNS |
denotes |
cells |
T3921 |
14784-14785 |
. |
denotes |
. |
T3922 |
14785-14891 |
sentence |
denotes |
However, more detailed functional studies are needed to demonstrate the real functions of these proteins. |
T3923 |
14786-14793 |
RB |
denotes |
However |
T3925 |
14793-14795 |
, |
denotes |
, |
T3926 |
14795-14799 |
RBR |
denotes |
more |
T3927 |
14800-14808 |
JJ |
denotes |
detailed |
T3929 |
14809-14819 |
JJ |
denotes |
functional |
T3928 |
14820-14827 |
NNS |
denotes |
studies |
T3930 |
14828-14831 |
VBP |
denotes |
are |
T3924 |
14832-14838 |
VBN |
denotes |
needed |
T3931 |
14839-14841 |
TO |
denotes |
to |
T3932 |
14842-14853 |
VB |
denotes |
demonstrate |
T3933 |
14854-14857 |
DT |
denotes |
the |
T3935 |
14858-14862 |
JJ |
denotes |
real |
T3934 |
14863-14872 |
NNS |
denotes |
functions |
T3936 |
14873-14875 |
IN |
denotes |
of |
T3937 |
14876-14881 |
DT |
denotes |
these |
T3938 |
14882-14890 |
NN |
denotes |
proteins |
T3939 |
14890-14891 |
. |
denotes |
. |
T4051 |
14905-14908 |
PRP$ |
denotes |
Our |
T4053 |
14909-14917 |
JJ |
denotes |
previous |
T4052 |
14918-14922 |
NN |
denotes |
work |
T4055 |
14923-14926 |
VBZ |
denotes |
has |
T4054 |
14927-14936 |
VBN |
denotes |
described |
T4056 |
14937-14942 |
JJ |
denotes |
human |
T4058 |
14943-14947 |
NN |
denotes |
ACDP |
T4057 |
14948-14953 |
NNS |
denotes |
genes |
T4059 |
14954-14955 |
-LRB- |
denotes |
[ |
T4060 |
14955-14956 |
CD |
denotes |
1 |
T4061 |
14956-14957 |
-RRB- |
denotes |
] |
T4062 |
14957-14958 |
. |
denotes |
. |
T4063 |
14958-15226 |
sentence |
denotes |
The new information of the current work includes: 1). It is the first time to report the existence of multiple Acdp genes in other mammals in addition to human, while Acdp appears to be a single copy gene in lower organisms such as in C. elegans, yeasts and bacteria. |
T4064 |
14959-14962 |
DT |
denotes |
The |
T4066 |
14963-14966 |
JJ |
denotes |
new |
T4065 |
14967-14978 |
NN |
denotes |
information |
T4068 |
14979-14981 |
IN |
denotes |
of |
T4069 |
14982-14985 |
DT |
denotes |
the |
T4071 |
14986-14993 |
JJ |
denotes |
current |
T4070 |
14994-14998 |
NN |
denotes |
work |
T4067 |
14999-15007 |
VBZ |
denotes |
includes |
T4073 |
15007-15009 |
: |
denotes |
: |
T4074 |
15009-15010 |
LS |
denotes |
1 |
T4075 |
15010-15011 |
-RRB- |
denotes |
) |
T4076 |
15011-15012 |
, |
denotes |
. |
T4077 |
15013-15015 |
PRP |
denotes |
It |
T4072 |
15016-15018 |
VBZ |
denotes |
is |
T4078 |
15019-15022 |
DT |
denotes |
the |
T4080 |
15023-15028 |
JJ |
denotes |
first |
T4079 |
15029-15033 |
NN |
denotes |
time |
T4081 |
15034-15036 |
TO |
denotes |
to |
T4082 |
15037-15043 |
VB |
denotes |
report |
T4083 |
15044-15047 |
DT |
denotes |
the |
T4084 |
15048-15057 |
NN |
denotes |
existence |
T4085 |
15058-15060 |
IN |
denotes |
of |
T4086 |
15061-15069 |
JJ |
denotes |
multiple |
T4088 |
15070-15074 |
NN |
denotes |
Acdp |
T4087 |
15075-15080 |
NNS |
denotes |
genes |
T4089 |
15081-15083 |
IN |
denotes |
in |
T4090 |
15084-15089 |
JJ |
denotes |
other |
T4091 |
15090-15097 |
NNS |
denotes |
mammals |
T4092 |
15098-15100 |
IN |
denotes |
in |
T4093 |
15101-15109 |
NN |
denotes |
addition |
T4094 |
15110-15112 |
IN |
denotes |
to |
T4095 |
15113-15118 |
NN |
denotes |
human |
T4096 |
15118-15120 |
, |
denotes |
, |
T4097 |
15120-15125 |
IN |
denotes |
while |
T4099 |
15126-15130 |
NN |
denotes |
Acdp |
T4098 |
15131-15138 |
VBZ |
denotes |
appears |
T4100 |
15139-15141 |
TO |
denotes |
to |
T4101 |
15142-15144 |
VB |
denotes |
be |
T4102 |
15145-15146 |
DT |
denotes |
a |
T4104 |
15147-15153 |
JJ |
denotes |
single |
T4105 |
15154-15158 |
NN |
denotes |
copy |
T4103 |
15159-15163 |
NN |
denotes |
gene |
T4106 |
15164-15166 |
IN |
denotes |
in |
T4107 |
15167-15172 |
JJR |
denotes |
lower |
T4108 |
15173-15182 |
NNS |
denotes |
organisms |
T4109 |
15183-15187 |
JJ |
denotes |
such |
T4110 |
15188-15190 |
IN |
denotes |
as |
T4111 |
15191-15193 |
IN |
denotes |
in |
T4112 |
15194-15196 |
NNP |
denotes |
C. |
T4113 |
15197-15204 |
NNP |
denotes |
elegans |
T4114 |
15204-15206 |
, |
denotes |
, |
T4115 |
15206-15212 |
NNS |
denotes |
yeasts |
T4116 |
15213-15216 |
CC |
denotes |
and |
T4117 |
15217-15225 |
NNS |
denotes |
bacteria |
T4118 |
15225-15226 |
. |
denotes |
. |
T4119 |
15226-15854 |
sentence |
denotes |
We have also suggested the evolutionary relationships of Acdp genes in different species (phylogenetic tree); 2). Molecular cloning and characterization of murine Acdp gene family are essential for study of this novel gene family in animal model, e.g. for generation of knockout or transgenic models; 3). We have demonstrated both DNA and amino acid conservations between mouse and human for each Acdp gene and the whole Acdp gene family, which provide important information for the possibility of functional redundancy or overlap between Acdp members; 4). We have generated antibodies specific for Acdp1 and all Acdp proteins. |
T4120 |
15227-15229 |
PRP |
denotes |
We |
T4122 |
15230-15234 |
VBP |
denotes |
have |
T4123 |
15235-15239 |
RB |
denotes |
also |
T4121 |
15240-15249 |
VBN |
denotes |
suggested |
T4125 |
15250-15253 |
DT |
denotes |
the |
T4127 |
15254-15266 |
JJ |
denotes |
evolutionary |
T4126 |
15267-15280 |
NNS |
denotes |
relationships |
T4128 |
15281-15283 |
IN |
denotes |
of |
T4129 |
15284-15288 |
NN |
denotes |
Acdp |
T4130 |
15289-15294 |
NNS |
denotes |
genes |
T4131 |
15295-15297 |
IN |
denotes |
in |
T4132 |
15298-15307 |
JJ |
denotes |
different |
T4133 |
15308-15315 |
NNS |
denotes |
species |
T4134 |
15316-15317 |
-LRB- |
denotes |
( |
T4136 |
15317-15329 |
JJ |
denotes |
phylogenetic |
T4135 |
15330-15334 |
NN |
denotes |
tree |
T4137 |
15334-15335 |
-RRB- |
denotes |
) |
T4138 |
15335-15336 |
: |
denotes |
; |
T4139 |
15337-15338 |
LS |
denotes |
2 |
T4141 |
15338-15339 |
-RRB- |
denotes |
) |
T4142 |
15339-15340 |
, |
denotes |
. |
T4143 |
15341-15350 |
JJ |
denotes |
Molecular |
T4144 |
15351-15358 |
NN |
denotes |
cloning |
T4145 |
15359-15362 |
CC |
denotes |
and |
T4146 |
15363-15379 |
NN |
denotes |
characterization |
T4147 |
15380-15382 |
IN |
denotes |
of |
T4148 |
15383-15389 |
JJ |
denotes |
murine |
T4150 |
15390-15394 |
NN |
denotes |
Acdp |
T4151 |
15395-15399 |
NN |
denotes |
gene |
T4149 |
15400-15406 |
NN |
denotes |
family |
T4140 |
15407-15410 |
VBP |
denotes |
are |
T4152 |
15411-15420 |
JJ |
denotes |
essential |
T4153 |
15421-15424 |
IN |
denotes |
for |
T4154 |
15425-15430 |
NN |
denotes |
study |
T4155 |
15431-15433 |
IN |
denotes |
of |
T4156 |
15434-15438 |
DT |
denotes |
this |
T4158 |
15439-15444 |
JJ |
denotes |
novel |
T4159 |
15445-15449 |
NN |
denotes |
gene |
T4157 |
15450-15456 |
NN |
denotes |
family |
T4160 |
15457-15459 |
IN |
denotes |
in |
T4161 |
15460-15466 |
NN |
denotes |
animal |
T4162 |
15467-15472 |
NN |
denotes |
model |
T4163 |
15472-15474 |
, |
denotes |
, |
T4164 |
15474-15478 |
FW |
denotes |
e.g. |
T4165 |
15479-15482 |
IN |
denotes |
for |
T4166 |
15483-15493 |
NN |
denotes |
generation |
T4167 |
15494-15496 |
IN |
denotes |
of |
T4168 |
15497-15505 |
NN |
denotes |
knockout |
T4170 |
15506-15508 |
CC |
denotes |
or |
T4171 |
15509-15519 |
JJ |
denotes |
transgenic |
T4169 |
15520-15526 |
NNS |
denotes |
models |
T4172 |
15526-15527 |
: |
denotes |
; |
T4173 |
15528-15529 |
LS |
denotes |
3 |
T4175 |
15529-15530 |
-RRB- |
denotes |
) |
T4176 |
15530-15531 |
, |
denotes |
. |
T4177 |
15532-15534 |
PRP |
denotes |
We |
T4178 |
15535-15539 |
VBP |
denotes |
have |
T4174 |
15540-15552 |
VBN |
denotes |
demonstrated |
T4179 |
15553-15557 |
CC |
denotes |
both |
T4180 |
15558-15561 |
NN |
denotes |
DNA |
T4182 |
15562-15565 |
CC |
denotes |
and |
T4183 |
15566-15571 |
NN |
denotes |
amino |
T4184 |
15572-15576 |
NN |
denotes |
acid |
T4181 |
15577-15590 |
NNS |
denotes |
conservations |
T4185 |
15591-15598 |
IN |
denotes |
between |
T4186 |
15599-15604 |
NN |
denotes |
mouse |
T4187 |
15605-15608 |
CC |
denotes |
and |
T4188 |
15609-15614 |
NN |
denotes |
human |
T4189 |
15615-15618 |
IN |
denotes |
for |
T4190 |
15619-15623 |
DT |
denotes |
each |
T4192 |
15624-15628 |
NN |
denotes |
Acdp |
T4191 |
15629-15633 |
NN |
denotes |
gene |
T4193 |
15634-15637 |
CC |
denotes |
and |
T4194 |
15638-15641 |
DT |
denotes |
the |
T4196 |
15642-15647 |
JJ |
denotes |
whole |
T4197 |
15648-15652 |
NN |
denotes |
Acdp |
T4198 |
15653-15657 |
NN |
denotes |
gene |
T4195 |
15658-15664 |
NN |
denotes |
family |
T4199 |
15664-15666 |
, |
denotes |
, |
T4200 |
15666-15671 |
WDT |
denotes |
which |
T4201 |
15672-15679 |
VBP |
denotes |
provide |
T4202 |
15680-15689 |
JJ |
denotes |
important |
T4203 |
15690-15701 |
NN |
denotes |
information |
T4204 |
15702-15705 |
IN |
denotes |
for |
T4205 |
15706-15709 |
DT |
denotes |
the |
T4206 |
15710-15721 |
NN |
denotes |
possibility |
T4207 |
15722-15724 |
IN |
denotes |
of |
T4208 |
15725-15735 |
JJ |
denotes |
functional |
T4209 |
15736-15746 |
NN |
denotes |
redundancy |
T4210 |
15747-15749 |
CC |
denotes |
or |
T4211 |
15750-15757 |
NN |
denotes |
overlap |
T4212 |
15758-15765 |
IN |
denotes |
between |
T4213 |
15766-15770 |
NN |
denotes |
Acdp |
T4214 |
15771-15778 |
NNS |
denotes |
members |
T4215 |
15778-15779 |
: |
denotes |
; |
T4216 |
15780-15781 |
LS |
denotes |
4 |
T4217 |
15781-15782 |
-RRB- |
denotes |
) |
T4218 |
15782-15783 |
, |
denotes |
. |
T4219 |
15784-15786 |
PRP |
denotes |
We |
T4220 |
15787-15791 |
VBP |
denotes |
have |
T4124 |
15792-15801 |
VBN |
denotes |
generated |
T4221 |
15802-15812 |
NNS |
denotes |
antibodies |
T4222 |
15813-15821 |
JJ |
denotes |
specific |
T4223 |
15822-15825 |
IN |
denotes |
for |
T4224 |
15826-15831 |
NN |
denotes |
Acdp1 |
T4225 |
15832-15835 |
CC |
denotes |
and |
T4226 |
15836-15839 |
DT |
denotes |
all |
T4228 |
15840-15844 |
NN |
denotes |
Acdp |
T4227 |
15845-15853 |
NN |
denotes |
proteins |
T4229 |
15853-15854 |
. |
denotes |
. |
T4230 |
15854-15925 |
sentence |
denotes |
The Acdp1 C-terminus antibody appears to specifically recognize Acdp1. |
T4231 |
15855-15858 |
DT |
denotes |
The |
T4233 |
15859-15864 |
NN |
denotes |
Acdp1 |
T4234 |
15865-15866 |
NN |
denotes |
C |
T4236 |
15866-15867 |
HYPH |
denotes |
- |
T4235 |
15867-15875 |
NN |
denotes |
terminus |
T4232 |
15876-15884 |
NN |
denotes |
antibody |
T4237 |
15885-15892 |
VBZ |
denotes |
appears |
T4238 |
15893-15895 |
TO |
denotes |
to |
T4240 |
15896-15908 |
RB |
denotes |
specifically |
T4239 |
15909-15918 |
VB |
denotes |
recognize |
T4241 |
15919-15924 |
NN |
denotes |
Acdp1 |
T4242 |
15924-15925 |
. |
denotes |
. |
T4243 |
15925-16052 |
sentence |
denotes |
Using this antibody, we have demonstrated that Acdp1 is predominantly localized on the plasma membrane in hippocampus neurons. |
T4244 |
15926-15931 |
VBG |
denotes |
Using |
T4246 |
15932-15936 |
DT |
denotes |
this |
T4247 |
15937-15945 |
NN |
denotes |
antibody |
T4248 |
15945-15947 |
, |
denotes |
, |
T4249 |
15947-15949 |
PRP |
denotes |
we |
T4250 |
15950-15954 |
VBP |
denotes |
have |
T4245 |
15955-15967 |
VBN |
denotes |
demonstrated |
T4251 |
15968-15972 |
IN |
denotes |
that |
T4253 |
15973-15978 |
NN |
denotes |
Acdp1 |
T4254 |
15979-15981 |
VBZ |
denotes |
is |
T4255 |
15982-15995 |
RB |
denotes |
predominantly |
T4252 |
15996-16005 |
VBN |
denotes |
localized |
T4256 |
16006-16008 |
IN |
denotes |
on |
T4257 |
16009-16012 |
DT |
denotes |
the |
T4259 |
16013-16019 |
NN |
denotes |
plasma |
T4258 |
16020-16028 |
NN |
denotes |
membrane |
T4260 |
16029-16031 |
IN |
denotes |
in |
T4261 |
16032-16043 |
NN |
denotes |
hippocampus |
T4262 |
16044-16051 |
NNS |
denotes |
neurons |
T4263 |
16051-16052 |
. |
denotes |
. |
T4264 |
16052-16162 |
sentence |
denotes |
These results represent an important step towards the characterization of functions for the Acdp gene family. |
T4265 |
16053-16058 |
DT |
denotes |
These |
T4266 |
16059-16066 |
NNS |
denotes |
results |
T4267 |
16067-16076 |
VBP |
denotes |
represent |
T4268 |
16077-16079 |
DT |
denotes |
an |
T4270 |
16080-16089 |
JJ |
denotes |
important |
T4269 |
16090-16094 |
NN |
denotes |
step |
T4271 |
16095-16102 |
IN |
denotes |
towards |
T4272 |
16103-16106 |
DT |
denotes |
the |
T4273 |
16107-16123 |
NN |
denotes |
characterization |
T4274 |
16124-16126 |
IN |
denotes |
of |
T4275 |
16127-16136 |
NNS |
denotes |
functions |
T4276 |
16137-16140 |
IN |
denotes |
for |
T4277 |
16141-16144 |
DT |
denotes |
the |
T4279 |
16145-16149 |
NN |
denotes |
Acdp |
T4280 |
16150-16154 |
NN |
denotes |
gene |
T4278 |
16155-16161 |
NN |
denotes |
family |
T4281 |
16161-16162 |
. |
denotes |
. |
T4392 |
16173-16177 |
NN |
denotes |
cDNA |
T4393 |
16178-16185 |
NN |
denotes |
cloning |
T4394 |
16185-16299 |
sentence |
denotes |
cDNA cloning of the Acdp gene family was performed based on human homologue sequences as previously reported [2]. |
T4395 |
16186-16190 |
NN |
denotes |
cDNA |
T4396 |
16191-16198 |
NN |
denotes |
cloning |
T4398 |
16199-16201 |
IN |
denotes |
of |
T4399 |
16202-16205 |
DT |
denotes |
the |
T4401 |
16206-16210 |
NN |
denotes |
Acdp |
T4402 |
16211-16215 |
NN |
denotes |
gene |
T4400 |
16216-16222 |
NN |
denotes |
family |
T4403 |
16223-16226 |
VBD |
denotes |
was |
T4397 |
16227-16236 |
VBN |
denotes |
performed |
T4404 |
16237-16242 |
VBN |
denotes |
based |
T4405 |
16243-16245 |
IN |
denotes |
on |
T4406 |
16246-16251 |
JJ |
denotes |
human |
T4408 |
16252-16261 |
NN |
denotes |
homologue |
T4407 |
16262-16271 |
NNS |
denotes |
sequences |
T4409 |
16272-16274 |
IN |
denotes |
as |
T4411 |
16275-16285 |
RB |
denotes |
previously |
T4410 |
16286-16294 |
VBN |
denotes |
reported |
T4412 |
16295-16296 |
-LRB- |
denotes |
[ |
T4413 |
16296-16297 |
CD |
denotes |
2 |
T4414 |
16297-16298 |
-RRB- |
denotes |
] |
T4415 |
16298-16299 |
. |
denotes |
. |
T4416 |
16299-16450 |
sentence |
denotes |
Briefly, the human ACDP cDNAs and predicted AA sequences were used to search the mouse EST database for EST markers corresponding to each Acdp member. |
T4417 |
16300-16307 |
RB |
denotes |
Briefly |
T4419 |
16307-16309 |
, |
denotes |
, |
T4420 |
16309-16312 |
DT |
denotes |
the |
T4422 |
16313-16318 |
JJ |
denotes |
human |
T4423 |
16319-16323 |
NN |
denotes |
ACDP |
T4421 |
16324-16329 |
NNS |
denotes |
cDNAs |
T4424 |
16330-16333 |
CC |
denotes |
and |
T4425 |
16334-16343 |
VBN |
denotes |
predicted |
T4427 |
16344-16346 |
NN |
denotes |
AA |
T4426 |
16347-16356 |
NNS |
denotes |
sequences |
T4428 |
16357-16361 |
VBD |
denotes |
were |
T4418 |
16362-16366 |
VBN |
denotes |
used |
T4429 |
16367-16369 |
TO |
denotes |
to |
T4430 |
16370-16376 |
VB |
denotes |
search |
T4431 |
16377-16380 |
DT |
denotes |
the |
T4433 |
16381-16386 |
NN |
denotes |
mouse |
T4434 |
16387-16390 |
NN |
denotes |
EST |
T4432 |
16391-16399 |
NN |
denotes |
database |
T4435 |
16400-16403 |
IN |
denotes |
for |
T4436 |
16404-16407 |
NN |
denotes |
EST |
T4437 |
16408-16415 |
NNS |
denotes |
markers |
T4438 |
16416-16429 |
VBG |
denotes |
corresponding |
T4439 |
16430-16432 |
IN |
denotes |
to |
T4440 |
16433-16437 |
DT |
denotes |
each |
T4442 |
16438-16442 |
NN |
denotes |
Acdp |
T4441 |
16443-16449 |
NN |
denotes |
member |
T4443 |
16449-16450 |
. |
denotes |
. |
T4444 |
16450-16689 |
sentence |
denotes |
A forward primer within the human ACDP 5' cDNA coding region (after start codon) and a mouse reverse primer from the mouse EST marker were used to amplify the homologue sequence from mouse cDNA at very low annealing temperature (45–50°C). |
T4445 |
16451-16452 |
DT |
denotes |
A |
T4447 |
16453-16460 |
JJ |
denotes |
forward |
T4446 |
16461-16467 |
NN |
denotes |
primer |
T4449 |
16468-16474 |
IN |
denotes |
within |
T4450 |
16475-16478 |
DT |
denotes |
the |
T4452 |
16479-16484 |
JJ |
denotes |
human |
T4453 |
16485-16489 |
NN |
denotes |
ACDP |
T4454 |
16490-16491 |
CD |
denotes |
5 |
T4455 |
16491-16492 |
SYM |
denotes |
' |
T4456 |
16493-16497 |
NN |
denotes |
cDNA |
T4457 |
16498-16504 |
NN |
denotes |
coding |
T4451 |
16505-16511 |
NN |
denotes |
region |
T4458 |
16512-16513 |
-LRB- |
denotes |
( |
T4459 |
16513-16518 |
IN |
denotes |
after |
T4460 |
16519-16524 |
NN |
denotes |
start |
T4461 |
16525-16530 |
NN |
denotes |
codon |
T4462 |
16530-16531 |
-RRB- |
denotes |
) |
T4463 |
16532-16535 |
CC |
denotes |
and |
T4464 |
16536-16537 |
DT |
denotes |
a |
T4466 |
16538-16543 |
NN |
denotes |
mouse |
T4467 |
16544-16551 |
JJ |
denotes |
reverse |
T4465 |
16552-16558 |
NN |
denotes |
primer |
T4468 |
16559-16563 |
IN |
denotes |
from |
T4469 |
16564-16567 |
DT |
denotes |
the |
T4471 |
16568-16573 |
NN |
denotes |
mouse |
T4472 |
16574-16577 |
NN |
denotes |
EST |
T4470 |
16578-16584 |
NN |
denotes |
marker |
T4473 |
16585-16589 |
VBD |
denotes |
were |
T4448 |
16590-16594 |
VBN |
denotes |
used |
T4474 |
16595-16597 |
TO |
denotes |
to |
T4475 |
16598-16605 |
VB |
denotes |
amplify |
T4476 |
16606-16609 |
DT |
denotes |
the |
T4478 |
16610-16619 |
NN |
denotes |
homologue |
T4477 |
16620-16628 |
NN |
denotes |
sequence |
T4479 |
16629-16633 |
IN |
denotes |
from |
T4480 |
16634-16639 |
NN |
denotes |
mouse |
T4481 |
16640-16644 |
NN |
denotes |
cDNA |
T4482 |
16645-16647 |
IN |
denotes |
at |
T4483 |
16648-16652 |
RB |
denotes |
very |
T4484 |
16653-16656 |
JJ |
denotes |
low |
T4486 |
16657-16666 |
VBG |
denotes |
annealing |
T4485 |
16667-16678 |
NN |
denotes |
temperature |
T4487 |
16679-16680 |
-LRB- |
denotes |
( |
T4488 |
16680-16682 |
CD |
denotes |
45 |
T4490 |
16682-16683 |
SYM |
denotes |
– |
T4489 |
16683-16685 |
CD |
denotes |
50 |
T4491 |
16685-16687 |
NN |
denotes |
°C |
T4492 |
16687-16688 |
-RRB- |
denotes |
) |
T4493 |
16688-16689 |
. |
denotes |
. |
T4494 |
16689-16923 |
sentence |
denotes |
A nested PCR using an inside reverse primer from the mouse EST sequence and the same human forward primer was then carried out to amplify the specific mouse gene from the first round PCR products at high annealing temperature (62°C). |
T4495 |
16690-16691 |
DT |
denotes |
A |
T4497 |
16692-16698 |
JJ |
denotes |
nested |
T4496 |
16699-16702 |
NN |
denotes |
PCR |
T4499 |
16703-16708 |
VBG |
denotes |
using |
T4500 |
16709-16711 |
DT |
denotes |
an |
T4502 |
16712-16718 |
JJ |
denotes |
inside |
T4503 |
16719-16726 |
JJ |
denotes |
reverse |
T4501 |
16727-16733 |
NN |
denotes |
primer |
T4504 |
16734-16738 |
IN |
denotes |
from |
T4505 |
16739-16742 |
DT |
denotes |
the |
T4507 |
16743-16748 |
NN |
denotes |
mouse |
T4508 |
16749-16752 |
NN |
denotes |
EST |
T4506 |
16753-16761 |
NN |
denotes |
sequence |
T4509 |
16762-16765 |
CC |
denotes |
and |
T4510 |
16766-16769 |
DT |
denotes |
the |
T4512 |
16770-16774 |
JJ |
denotes |
same |
T4513 |
16775-16780 |
JJ |
denotes |
human |
T4514 |
16781-16788 |
JJ |
denotes |
forward |
T4511 |
16789-16795 |
NN |
denotes |
primer |
T4515 |
16796-16799 |
VBD |
denotes |
was |
T4516 |
16800-16804 |
RB |
denotes |
then |
T4498 |
16805-16812 |
VBN |
denotes |
carried |
T4517 |
16813-16816 |
RP |
denotes |
out |
T4518 |
16817-16819 |
TO |
denotes |
to |
T4519 |
16820-16827 |
VB |
denotes |
amplify |
T4520 |
16828-16831 |
DT |
denotes |
the |
T4522 |
16832-16840 |
JJ |
denotes |
specific |
T4523 |
16841-16846 |
NN |
denotes |
mouse |
T4521 |
16847-16851 |
NN |
denotes |
gene |
T4524 |
16852-16856 |
IN |
denotes |
from |
T4525 |
16857-16860 |
DT |
denotes |
the |
T4527 |
16861-16866 |
JJ |
denotes |
first |
T4528 |
16867-16872 |
NN |
denotes |
round |
T4529 |
16873-16876 |
NN |
denotes |
PCR |
T4526 |
16877-16885 |
NNS |
denotes |
products |
T4530 |
16886-16888 |
IN |
denotes |
at |
T4531 |
16889-16893 |
JJ |
denotes |
high |
T4533 |
16894-16903 |
VBG |
denotes |
annealing |
T4532 |
16904-16915 |
NN |
denotes |
temperature |
T4534 |
16916-16917 |
-LRB- |
denotes |
( |
T4535 |
16917-16919 |
CD |
denotes |
62 |
T4536 |
16919-16921 |
NN |
denotes |
°C |
T4537 |
16921-16922 |
-RRB- |
denotes |
) |
T4538 |
16922-16923 |
. |
denotes |
. |
T4539 |
16923-17036 |
sentence |
denotes |
The expected PCR products were directly excised from agarose gel and sequenced by an ABI377 automatic sequencer. |
T4540 |
16924-16927 |
DT |
denotes |
The |
T4542 |
16928-16936 |
JJ |
denotes |
expected |
T4543 |
16937-16940 |
NN |
denotes |
PCR |
T4541 |
16941-16949 |
NNS |
denotes |
products |
T4545 |
16950-16954 |
VBD |
denotes |
were |
T4546 |
16955-16963 |
RB |
denotes |
directly |
T4544 |
16964-16971 |
VBN |
denotes |
excised |
T4547 |
16972-16976 |
IN |
denotes |
from |
T4548 |
16977-16984 |
NN |
denotes |
agarose |
T4549 |
16985-16988 |
NN |
denotes |
gel |
T4550 |
16989-16992 |
CC |
denotes |
and |
T4551 |
16993-17002 |
VBN |
denotes |
sequenced |
T4552 |
17003-17005 |
IN |
denotes |
by |
T4553 |
17006-17008 |
DT |
denotes |
an |
T4555 |
17009-17015 |
NN |
denotes |
ABI377 |
T4556 |
17016-17025 |
JJ |
denotes |
automatic |
T4554 |
17026-17035 |
NN |
denotes |
sequencer |
T4557 |
17035-17036 |
. |
denotes |
. |
T4558 |
17036-17167 |
sentence |
denotes |
The sequence was further confirmed using a forward primer from newly identified sequence and a reverse primer from known sequence. |
T4559 |
17037-17040 |
DT |
denotes |
The |
T4560 |
17041-17049 |
NN |
denotes |
sequence |
T4562 |
17050-17053 |
VBD |
denotes |
was |
T4563 |
17054-17061 |
RB |
denotes |
further |
T4561 |
17062-17071 |
VBN |
denotes |
confirmed |
T4564 |
17072-17077 |
VBG |
denotes |
using |
T4565 |
17078-17079 |
DT |
denotes |
a |
T4567 |
17080-17087 |
JJ |
denotes |
forward |
T4566 |
17088-17094 |
NN |
denotes |
primer |
T4568 |
17095-17099 |
IN |
denotes |
from |
T4569 |
17100-17105 |
RB |
denotes |
newly |
T4570 |
17106-17116 |
VBN |
denotes |
identified |
T4571 |
17117-17125 |
NN |
denotes |
sequence |
T4572 |
17126-17129 |
CC |
denotes |
and |
T4573 |
17130-17131 |
DT |
denotes |
a |
T4575 |
17132-17139 |
JJ |
denotes |
reverse |
T4574 |
17140-17146 |
NN |
denotes |
primer |
T4576 |
17147-17151 |
IN |
denotes |
from |
T4577 |
17152-17157 |
JJ |
denotes |
known |
T4578 |
17158-17166 |
NN |
denotes |
sequence |
T4579 |
17166-17167 |
. |
denotes |
. |
T4580 |
17167-17307 |
sentence |
denotes |
Once most of the coding sequences were identified, partial sequence of exon 1 and the 5' UTR sequences were obtained by BAC DNA sequencing. |
T4581 |
17168-17172 |
IN |
denotes |
Once |
T4583 |
17173-17177 |
JJS |
denotes |
most |
T4584 |
17178-17180 |
IN |
denotes |
of |
T4585 |
17181-17184 |
DT |
denotes |
the |
T4587 |
17185-17191 |
VBG |
denotes |
coding |
T4586 |
17192-17201 |
NNS |
denotes |
sequences |
T4588 |
17202-17206 |
VBD |
denotes |
were |
T4582 |
17207-17217 |
VBN |
denotes |
identified |
T4590 |
17217-17219 |
, |
denotes |
, |
T4591 |
17219-17226 |
JJ |
denotes |
partial |
T4592 |
17227-17235 |
NN |
denotes |
sequence |
T4593 |
17236-17238 |
IN |
denotes |
of |
T4594 |
17239-17243 |
NN |
denotes |
exon |
T4596 |
17244-17245 |
CD |
denotes |
1 |
T4597 |
17246-17249 |
CC |
denotes |
and |
T4598 |
17250-17253 |
DT |
denotes |
the |
T4600 |
17254-17255 |
CD |
denotes |
5 |
T4601 |
17255-17256 |
SYM |
denotes |
' |
T4599 |
17257-17260 |
NN |
denotes |
UTR |
T4595 |
17261-17270 |
NNS |
denotes |
sequences |
T4602 |
17271-17275 |
VBD |
denotes |
were |
T4589 |
17276-17284 |
VBN |
denotes |
obtained |
T4603 |
17285-17287 |
IN |
denotes |
by |
T4604 |
17288-17291 |
NN |
denotes |
BAC |
T4606 |
17292-17295 |
NN |
denotes |
DNA |
T4605 |
17296-17306 |
NN |
denotes |
sequencing |
T4607 |
17306-17307 |
. |
denotes |
. |
T4647 |
17309-17317 |
NNP |
denotes |
Northern |
T4648 |
17318-17322 |
NN |
denotes |
blot |
T4649 |
17323-17331 |
NNS |
denotes |
analyses |
T4650 |
17331-17436 |
sentence |
denotes |
Multiple Choice Northern Blot filters containing 12 different mouse tissues were purchased from Origene. |
T4651 |
17332-17340 |
JJ |
denotes |
Multiple |
T4653 |
17341-17347 |
NN |
denotes |
Choice |
T4654 |
17348-17356 |
NNP |
denotes |
Northern |
T4655 |
17357-17361 |
NN |
denotes |
Blot |
T4652 |
17362-17369 |
NNS |
denotes |
filters |
T4657 |
17370-17380 |
VBG |
denotes |
containing |
T4658 |
17381-17383 |
CD |
denotes |
12 |
T4660 |
17384-17393 |
JJ |
denotes |
different |
T4661 |
17394-17399 |
NN |
denotes |
mouse |
T4659 |
17400-17407 |
NNS |
denotes |
tissues |
T4662 |
17408-17412 |
VBD |
denotes |
were |
T4656 |
17413-17422 |
VBN |
denotes |
purchased |
T4663 |
17423-17427 |
IN |
denotes |
from |
T4664 |
17428-17435 |
NNP |
denotes |
Origene |
T4665 |
17435-17436 |
. |
denotes |
. |
T4666 |
17436-17647 |
sentence |
denotes |
The filters were probed for each Acdp gene with a PCR fragment (around 350 bp) from last exon and the 3' untranslated region labeled with α-32P dCTP using the random primer extension system (Life Technologies). |
T4667 |
17437-17440 |
DT |
denotes |
The |
T4668 |
17441-17448 |
NNS |
denotes |
filters |
T4670 |
17449-17453 |
VBD |
denotes |
were |
T4669 |
17454-17460 |
VBN |
denotes |
probed |
T4671 |
17461-17464 |
IN |
denotes |
for |
T4672 |
17465-17469 |
DT |
denotes |
each |
T4674 |
17470-17474 |
NN |
denotes |
Acdp |
T4673 |
17475-17479 |
NN |
denotes |
gene |
T4675 |
17480-17484 |
IN |
denotes |
with |
T4676 |
17485-17486 |
DT |
denotes |
a |
T4678 |
17487-17490 |
NN |
denotes |
PCR |
T4677 |
17491-17499 |
NN |
denotes |
fragment |
T4679 |
17500-17501 |
-LRB- |
denotes |
( |
T4681 |
17501-17507 |
IN |
denotes |
around |
T4682 |
17508-17511 |
CD |
denotes |
350 |
T4680 |
17512-17514 |
NN |
denotes |
bp |
T4683 |
17514-17515 |
-RRB- |
denotes |
) |
T4684 |
17516-17520 |
IN |
denotes |
from |
T4685 |
17521-17525 |
JJ |
denotes |
last |
T4686 |
17526-17530 |
NN |
denotes |
exon |
T4687 |
17531-17534 |
CC |
denotes |
and |
T4688 |
17535-17538 |
DT |
denotes |
the |
T4689 |
17539-17540 |
CD |
denotes |
3 |
T4691 |
17540-17541 |
SYM |
denotes |
' |
T4692 |
17542-17554 |
JJ |
denotes |
untranslated |
T4690 |
17555-17561 |
NN |
denotes |
region |
T4693 |
17562-17569 |
VBN |
denotes |
labeled |
T4694 |
17570-17574 |
IN |
denotes |
with |
T4695 |
17575-17576 |
NN |
denotes |
α |
T4697 |
17576-17577 |
HYPH |
denotes |
- |
T4696 |
17577-17580 |
NN |
denotes |
32P |
T4698 |
17581-17585 |
NN |
denotes |
dCTP |
T4699 |
17586-17591 |
VBG |
denotes |
using |
T4700 |
17592-17595 |
DT |
denotes |
the |
T4702 |
17596-17602 |
JJ |
denotes |
random |
T4703 |
17603-17609 |
NN |
denotes |
primer |
T4704 |
17610-17619 |
NN |
denotes |
extension |
T4701 |
17620-17626 |
NN |
denotes |
system |
T4705 |
17627-17628 |
-LRB- |
denotes |
( |
T4707 |
17628-17632 |
NNP |
denotes |
Life |
T4706 |
17633-17645 |
NNP |
denotes |
Technologies |
T4708 |
17645-17646 |
-RRB- |
denotes |
) |
T4709 |
17646-17647 |
. |
denotes |
. |
T4710 |
17647-17690 |
sentence |
denotes |
Hybridizations were carried out overnight. |
T4711 |
17648-17662 |
NNS |
denotes |
Hybridizations |
T4713 |
17663-17667 |
VBD |
denotes |
were |
T4712 |
17668-17675 |
VBN |
denotes |
carried |
T4714 |
17676-17679 |
RP |
denotes |
out |
T4715 |
17680-17689 |
RB |
denotes |
overnight |
T4716 |
17689-17690 |
. |
denotes |
. |
T4717 |
17690-17866 |
sentence |
denotes |
The filters were washed twice with washing buffer I (2×SSC, 0.1% SDS) at 42°C for 15-min, and then washed twice with washing buffer II (0.25×SSC, 0.1% SDS) at 65°C for 15-min. |
T4718 |
17691-17694 |
DT |
denotes |
The |
T4719 |
17695-17702 |
NNS |
denotes |
filters |
T4721 |
17703-17707 |
VBD |
denotes |
were |
T4720 |
17708-17714 |
VBN |
denotes |
washed |
T4722 |
17715-17720 |
RB |
denotes |
twice |
T4723 |
17721-17725 |
IN |
denotes |
with |
T4724 |
17726-17733 |
VBG |
denotes |
washing |
T4725 |
17734-17740 |
NN |
denotes |
buffer |
T4726 |
17741-17742 |
CD |
denotes |
I |
T4727 |
17743-17744 |
-LRB- |
denotes |
( |
T4729 |
17744-17745 |
CD |
denotes |
2 |
T4731 |
17745-17746 |
SYM |
denotes |
× |
T4730 |
17746-17749 |
NN |
denotes |
SSC |
T4732 |
17749-17751 |
, |
denotes |
, |
T4733 |
17751-17754 |
CD |
denotes |
0.1 |
T4734 |
17754-17755 |
NN |
denotes |
% |
T4728 |
17756-17759 |
NN |
denotes |
SDS |
T4735 |
17759-17760 |
-RRB- |
denotes |
) |
T4736 |
17761-17763 |
IN |
denotes |
at |
T4737 |
17764-17766 |
CD |
denotes |
42 |
T4738 |
17766-17768 |
NN |
denotes |
°C |
T4739 |
17769-17772 |
IN |
denotes |
for |
T4740 |
17773-17775 |
CD |
denotes |
15 |
T4742 |
17775-17776 |
HYPH |
denotes |
- |
T4741 |
17776-17779 |
NN |
denotes |
min |
T4743 |
17779-17781 |
, |
denotes |
, |
T4744 |
17781-17784 |
CC |
denotes |
and |
T4745 |
17785-17789 |
RB |
denotes |
then |
T4746 |
17790-17796 |
VBD |
denotes |
washed |
T4747 |
17797-17802 |
RB |
denotes |
twice |
T4748 |
17803-17807 |
IN |
denotes |
with |
T4749 |
17808-17815 |
NN |
denotes |
washing |
T4750 |
17816-17822 |
NN |
denotes |
buffer |
T4751 |
17823-17825 |
CD |
denotes |
II |
T4752 |
17826-17827 |
-LRB- |
denotes |
( |
T4754 |
17827-17831 |
CD |
denotes |
0.25 |
T4756 |
17831-17832 |
SYM |
denotes |
× |
T4755 |
17832-17835 |
NN |
denotes |
SSC |
T4757 |
17835-17837 |
, |
denotes |
, |
T4758 |
17837-17840 |
CD |
denotes |
0.1 |
T4759 |
17840-17841 |
NN |
denotes |
% |
T4753 |
17842-17845 |
NN |
denotes |
SDS |
T4760 |
17845-17846 |
-RRB- |
denotes |
) |
T4761 |
17847-17849 |
IN |
denotes |
at |
T4762 |
17850-17852 |
CD |
denotes |
65 |
T4763 |
17852-17854 |
NN |
denotes |
°C |
T4764 |
17855-17858 |
IN |
denotes |
for |
T4765 |
17859-17861 |
CD |
denotes |
15 |
T4767 |
17861-17862 |
HYPH |
denotes |
- |
T4766 |
17862-17865 |
NN |
denotes |
min |
T4768 |
17865-17866 |
. |
denotes |
. |
T4769 |
17866-17940 |
sentence |
denotes |
Washed filters were exposed to X-ray films for overnight or longer [3,4]. |
T4770 |
17867-17873 |
JJ |
denotes |
Washed |
T4771 |
17874-17881 |
NNS |
denotes |
filters |
T4773 |
17882-17886 |
VBD |
denotes |
were |
T4772 |
17887-17894 |
VBN |
denotes |
exposed |
T4774 |
17895-17897 |
IN |
denotes |
to |
T4775 |
17898-17903 |
NN |
denotes |
X-ray |
T4776 |
17904-17909 |
NNS |
denotes |
films |
T4777 |
17910-17913 |
IN |
denotes |
for |
T4778 |
17914-17923 |
NN |
denotes |
overnight |
T4779 |
17924-17926 |
CC |
denotes |
or |
T4780 |
17927-17933 |
RBR |
denotes |
longer |
T4781 |
17934-17935 |
-LRB- |
denotes |
[ |
T4783 |
17935-17936 |
CD |
denotes |
3 |
T4784 |
17936-17937 |
, |
denotes |
, |
T4782 |
17937-17938 |
CD |
denotes |
4 |
T4785 |
17938-17939 |
-RRB- |
denotes |
] |
T4786 |
17939-17940 |
. |
denotes |
. |
T4823 |
17942-17950 |
NN |
denotes |
Antibody |
T4824 |
17951-17961 |
NN |
denotes |
production |
T4825 |
17962-17965 |
CC |
denotes |
and |
T4826 |
17966-17973 |
NNP |
denotes |
Western |
T4827 |
17974-17978 |
NN |
denotes |
blot |
T4828 |
17979-17987 |
NNS |
denotes |
analyses |
T4829 |
17987-18213 |
sentence |
denotes |
Peptides linked to KLH (keyhole limpet hemacyanin) from Acdp1 N- and C-terminals and the conserved domain (ACD) were used for generation of antibodies specifically for Acdp1 and all Acdp members as reported, respectively [5]. |
T4830 |
17988-17996 |
NNS |
denotes |
Peptides |
T4832 |
17997-18003 |
VBN |
denotes |
linked |
T4833 |
18004-18006 |
IN |
denotes |
to |
T4834 |
18007-18010 |
NN |
denotes |
KLH |
T4835 |
18011-18012 |
-LRB- |
denotes |
( |
T4836 |
18012-18019 |
NN |
denotes |
keyhole |
T4838 |
18020-18026 |
NN |
denotes |
limpet |
T4837 |
18027-18037 |
NN |
denotes |
hemacyanin |
T4839 |
18037-18038 |
-RRB- |
denotes |
) |
T4840 |
18039-18043 |
IN |
denotes |
from |
T4841 |
18044-18049 |
NN |
denotes |
Acdp1 |
T4843 |
18050-18051 |
NN |
denotes |
N |
T4844 |
18051-18052 |
HYPH |
denotes |
- |
T4845 |
18053-18056 |
CC |
denotes |
and |
T4846 |
18057-18058 |
NN |
denotes |
C |
T4847 |
18058-18059 |
HYPH |
denotes |
- |
T4842 |
18059-18068 |
NNS |
denotes |
terminals |
T4848 |
18069-18072 |
CC |
denotes |
and |
T4849 |
18073-18076 |
DT |
denotes |
the |
T4851 |
18077-18086 |
VBN |
denotes |
conserved |
T4850 |
18087-18093 |
NN |
denotes |
domain |
T4852 |
18094-18095 |
-LRB- |
denotes |
( |
T4853 |
18095-18098 |
NN |
denotes |
ACD |
T4854 |
18098-18099 |
-RRB- |
denotes |
) |
T4855 |
18100-18104 |
VBD |
denotes |
were |
T4831 |
18105-18109 |
VBN |
denotes |
used |
T4856 |
18110-18113 |
IN |
denotes |
for |
T4857 |
18114-18124 |
NN |
denotes |
generation |
T4858 |
18125-18127 |
IN |
denotes |
of |
T4859 |
18128-18138 |
NNS |
denotes |
antibodies |
T4860 |
18139-18151 |
RB |
denotes |
specifically |
T4861 |
18152-18155 |
IN |
denotes |
for |
T4862 |
18156-18161 |
NN |
denotes |
Acdp1 |
T4863 |
18162-18165 |
CC |
denotes |
and |
T4864 |
18166-18169 |
DT |
denotes |
all |
T4866 |
18170-18174 |
NN |
denotes |
Acdp |
T4865 |
18175-18182 |
NNS |
denotes |
members |
T4867 |
18183-18185 |
IN |
denotes |
as |
T4868 |
18186-18194 |
VBN |
denotes |
reported |
T4869 |
18194-18196 |
, |
denotes |
, |
T4870 |
18196-18208 |
RB |
denotes |
respectively |
T4871 |
18209-18210 |
-LRB- |
denotes |
[ |
T4872 |
18210-18211 |
CD |
denotes |
5 |
T4873 |
18211-18212 |
-RRB- |
denotes |
] |
T4874 |
18212-18213 |
. |
denotes |
. |
T4875 |
18213-18292 |
sentence |
denotes |
Western blots were carried out Using ECL (PIERCE) as described previously [1]. |
T4876 |
18214-18221 |
NNP |
denotes |
Western |
T4877 |
18222-18227 |
NNS |
denotes |
blots |
T4879 |
18228-18232 |
VBD |
denotes |
were |
T4878 |
18233-18240 |
VBN |
denotes |
carried |
T4880 |
18241-18244 |
RP |
denotes |
out |
T4881 |
18245-18250 |
VBG |
denotes |
Using |
T4882 |
18251-18254 |
NN |
denotes |
ECL |
T4883 |
18255-18256 |
-LRB- |
denotes |
( |
T4884 |
18256-18262 |
NN |
denotes |
PIERCE |
T4885 |
18262-18263 |
-RRB- |
denotes |
) |
T4886 |
18264-18266 |
IN |
denotes |
as |
T4887 |
18267-18276 |
VBN |
denotes |
described |
T4888 |
18277-18287 |
RB |
denotes |
previously |
T4889 |
18288-18289 |
-LRB- |
denotes |
[ |
T4890 |
18289-18290 |
CD |
denotes |
1 |
T4891 |
18290-18291 |
-RRB- |
denotes |
] |
T4892 |
18291-18292 |
. |
denotes |
. |
T4893 |
18292-18454 |
sentence |
denotes |
The membranes were washed extensively after incubation with primary and secondary antibodies and were then developed with X-ray films with optimal exposure time. |
T4894 |
18293-18296 |
DT |
denotes |
The |
T4895 |
18297-18306 |
NNS |
denotes |
membranes |
T4897 |
18307-18311 |
VBD |
denotes |
were |
T4896 |
18312-18318 |
VBN |
denotes |
washed |
T4898 |
18319-18330 |
RB |
denotes |
extensively |
T4899 |
18331-18336 |
IN |
denotes |
after |
T4900 |
18337-18347 |
NN |
denotes |
incubation |
T4901 |
18348-18352 |
IN |
denotes |
with |
T4902 |
18353-18360 |
JJ |
denotes |
primary |
T4904 |
18361-18364 |
CC |
denotes |
and |
T4905 |
18365-18374 |
JJ |
denotes |
secondary |
T4903 |
18375-18385 |
NNS |
denotes |
antibodies |
T4906 |
18386-18389 |
CC |
denotes |
and |
T4907 |
18390-18394 |
VBD |
denotes |
were |
T4909 |
18395-18399 |
RB |
denotes |
then |
T4908 |
18400-18409 |
VBN |
denotes |
developed |
T4910 |
18410-18414 |
IN |
denotes |
with |
T4911 |
18415-18420 |
NN |
denotes |
X-ray |
T4912 |
18421-18426 |
NNS |
denotes |
films |
T4913 |
18427-18431 |
IN |
denotes |
with |
T4914 |
18432-18439 |
JJ |
denotes |
optimal |
T4916 |
18440-18448 |
NN |
denotes |
exposure |
T4915 |
18449-18453 |
NN |
denotes |
time |
T4917 |
18453-18454 |
. |
denotes |
. |
T4941 |
18456-18466 |
NN |
denotes |
Chromosome |
T4942 |
18467-18479 |
NN |
denotes |
localization |
T4943 |
18479-18600 |
sentence |
denotes |
The T31 mouse radiation hybrid panel from Research Genetics was used to map the chromosome location of each Acdp member. |
T4944 |
18480-18483 |
DT |
denotes |
The |
T4946 |
18484-18487 |
NN |
denotes |
T31 |
T4947 |
18488-18493 |
NN |
denotes |
mouse |
T4948 |
18494-18503 |
NN |
denotes |
radiation |
T4949 |
18504-18510 |
NN |
denotes |
hybrid |
T4945 |
18511-18516 |
NN |
denotes |
panel |
T4951 |
18517-18521 |
IN |
denotes |
from |
T4952 |
18522-18530 |
NNP |
denotes |
Research |
T4953 |
18531-18539 |
NNP |
denotes |
Genetics |
T4954 |
18540-18543 |
VBD |
denotes |
was |
T4950 |
18544-18548 |
VBN |
denotes |
used |
T4955 |
18549-18551 |
TO |
denotes |
to |
T4956 |
18552-18555 |
VB |
denotes |
map |
T4957 |
18556-18559 |
DT |
denotes |
the |
T4959 |
18560-18570 |
NN |
denotes |
chromosome |
T4958 |
18571-18579 |
NN |
denotes |
location |
T4960 |
18580-18582 |
IN |
denotes |
of |
T4961 |
18583-18587 |
DT |
denotes |
each |
T4963 |
18588-18592 |
NN |
denotes |
Acdp |
T4962 |
18593-18599 |
NN |
denotes |
member |
T4964 |
18599-18600 |
. |
denotes |
. |
T4965 |
18600-18724 |
sentence |
denotes |
Primers from 3' UTR of each Acdp member were used to amplify the 100 radiation hybrid clones representing the mouse genome. |
T4966 |
18601-18608 |
NNS |
denotes |
Primers |
T4968 |
18609-18613 |
IN |
denotes |
from |
T4969 |
18614-18615 |
CD |
denotes |
3 |
T4971 |
18615-18616 |
SYM |
denotes |
' |
T4970 |
18617-18620 |
NN |
denotes |
UTR |
T4972 |
18621-18623 |
IN |
denotes |
of |
T4973 |
18624-18628 |
DT |
denotes |
each |
T4975 |
18629-18633 |
NN |
denotes |
Acdp |
T4974 |
18634-18640 |
NN |
denotes |
member |
T4976 |
18641-18645 |
VBD |
denotes |
were |
T4967 |
18646-18650 |
VBN |
denotes |
used |
T4977 |
18651-18653 |
TO |
denotes |
to |
T4978 |
18654-18661 |
VB |
denotes |
amplify |
T4979 |
18662-18665 |
DT |
denotes |
the |
T4981 |
18666-18669 |
CD |
denotes |
100 |
T4982 |
18670-18679 |
NN |
denotes |
radiation |
T4983 |
18680-18686 |
JJ |
denotes |
hybrid |
T4980 |
18687-18693 |
NNS |
denotes |
clones |
T4984 |
18694-18706 |
VBG |
denotes |
representing |
T4985 |
18707-18710 |
DT |
denotes |
the |
T4987 |
18711-18716 |
NN |
denotes |
mouse |
T4986 |
18717-18723 |
NN |
denotes |
genome |
T4988 |
18723-18724 |
. |
denotes |
. |
T4989 |
18724-18820 |
sentence |
denotes |
The data were submitted to the Jackson Laboratory Mouse Radiation Hybrid Database for analysis. |
T4990 |
18725-18728 |
DT |
denotes |
The |
T4991 |
18729-18733 |
NNS |
denotes |
data |
T4993 |
18734-18738 |
VBD |
denotes |
were |
T4992 |
18739-18748 |
VBN |
denotes |
submitted |
T4994 |
18749-18751 |
IN |
denotes |
to |
T4995 |
18752-18755 |
DT |
denotes |
the |
T4997 |
18756-18763 |
NNP |
denotes |
Jackson |
T4998 |
18764-18774 |
NNP |
denotes |
Laboratory |
T4999 |
18775-18780 |
NNP |
denotes |
Mouse |
T5001 |
18781-18790 |
NNP |
denotes |
Radiation |
T5000 |
18791-18797 |
NNP |
denotes |
Hybrid |
T4996 |
18798-18806 |
NNP |
denotes |
Database |
T5002 |
18807-18810 |
IN |
denotes |
for |
T5003 |
18811-18819 |
NN |
denotes |
analysis |
T5004 |
18819-18820 |
. |
denotes |
. |
T5023 |
18822-18830 |
NN |
denotes |
Sequence |
T5024 |
18831-18839 |
NNS |
denotes |
analyses |
T5025 |
18839-18914 |
sentence |
denotes |
Sequence assembly was performed with program Sequencher (Gene Codes Corp). |
T5026 |
18840-18848 |
NN |
denotes |
Sequence |
T5027 |
18849-18857 |
NN |
denotes |
assembly |
T5029 |
18858-18861 |
VBD |
denotes |
was |
T5028 |
18862-18871 |
VBN |
denotes |
performed |
T5030 |
18872-18876 |
IN |
denotes |
with |
T5031 |
18877-18884 |
NN |
denotes |
program |
T5032 |
18885-18895 |
NN |
denotes |
Sequencher |
T5033 |
18896-18897 |
-LRB- |
denotes |
( |
T5035 |
18897-18901 |
NNP |
denotes |
Gene |
T5036 |
18902-18907 |
NNPS |
denotes |
Codes |
T5034 |
18908-18912 |
NNP |
denotes |
Corp |
T5037 |
18912-18913 |
-RRB- |
denotes |
) |
T5038 |
18913-18914 |
. |
denotes |
. |
T5039 |
18914-19017 |
sentence |
denotes |
Protein and DNA homology searches were carried out with tblastn, tblastx, blastp and blastn programs . |
T5040 |
18915-18922 |
NN |
denotes |
Protein |
T5042 |
18923-18926 |
CC |
denotes |
and |
T5043 |
18927-18930 |
NN |
denotes |
DNA |
T5041 |
18931-18939 |
NN |
denotes |
homology |
T5044 |
18940-18948 |
NNS |
denotes |
searches |
T5046 |
18949-18953 |
VBD |
denotes |
were |
T5045 |
18954-18961 |
VBN |
denotes |
carried |
T5047 |
18962-18965 |
RP |
denotes |
out |
T5048 |
18966-18970 |
IN |
denotes |
with |
T5049 |
18971-18978 |
NN |
denotes |
tblastn |
T5051 |
18978-18980 |
, |
denotes |
, |
T5052 |
18980-18987 |
NN |
denotes |
tblastx |
T5053 |
18987-18989 |
, |
denotes |
, |
T5054 |
18989-18995 |
NN |
denotes |
blastp |
T5055 |
18996-18999 |
CC |
denotes |
and |
T5056 |
19000-19006 |
NN |
denotes |
blastn |
T5050 |
19007-19015 |
NNS |
denotes |
programs |
T5057 |
19016-19017 |
. |
denotes |
. |
T5058 |
19017-19108 |
sentence |
denotes |
Multiple sequence alignments were performed with GeneDoc and pairwise sequence alignment . |
T5059 |
19018-19026 |
JJ |
denotes |
Multiple |
T5061 |
19027-19035 |
NN |
denotes |
sequence |
T5060 |
19036-19046 |
NNS |
denotes |
alignments |
T5063 |
19047-19051 |
VBD |
denotes |
were |
T5062 |
19052-19061 |
VBN |
denotes |
performed |
T5064 |
19062-19066 |
IN |
denotes |
with |
T5065 |
19067-19074 |
NN |
denotes |
GeneDoc |
T5067 |
19075-19078 |
CC |
denotes |
and |
T5068 |
19079-19087 |
JJ |
denotes |
pairwise |
T5069 |
19088-19096 |
NN |
denotes |
sequence |
T5066 |
19097-19106 |
NN |
denotes |
alignment |
T5070 |
19107-19108 |
. |
denotes |
. |
T5071 |
19108-19276 |
sentence |
denotes |
Multiple programs including BCM Search Launcher , ProfileScan , sequence motif search , ExPASy and 3Dpssm were used for searching sequence features of known protein. |
T5072 |
19109-19117 |
JJ |
denotes |
Multiple |
T5073 |
19118-19126 |
NNS |
denotes |
programs |
T5075 |
19127-19136 |
VBG |
denotes |
including |
T5076 |
19137-19140 |
NN |
denotes |
BCM |
T5078 |
19141-19147 |
NN |
denotes |
Search |
T5077 |
19148-19156 |
NN |
denotes |
Launcher |
T5079 |
19157-19159 |
, |
denotes |
, |
T5080 |
19159-19170 |
NN |
denotes |
ProfileScan |
T5081 |
19171-19173 |
, |
denotes |
, |
T5082 |
19173-19181 |
NN |
denotes |
sequence |
T5084 |
19182-19187 |
NN |
denotes |
motif |
T5083 |
19188-19194 |
NN |
denotes |
search |
T5085 |
19195-19197 |
, |
denotes |
, |
T5086 |
19197-19203 |
NN |
denotes |
ExPASy |
T5087 |
19205-19208 |
CC |
denotes |
and |
T5088 |
19209-19215 |
NN |
denotes |
3Dpssm |
T5089 |
19217-19221 |
VBD |
denotes |
were |
T5074 |
19222-19226 |
VBN |
denotes |
used |
T5090 |
19227-19230 |
IN |
denotes |
for |
T5091 |
19231-19240 |
VBG |
denotes |
searching |
T5092 |
19241-19249 |
NN |
denotes |
sequence |
T5093 |
19250-19258 |
NNS |
denotes |
features |
T5094 |
19259-19261 |
IN |
denotes |
of |
T5095 |
19262-19267 |
JJ |
denotes |
known |
T5096 |
19268-19275 |
NN |
denotes |
protein |
T5097 |
19275-19276 |
. |
denotes |
. |
T5098 |
19276-19430 |
sentence |
denotes |
Phylogenetic tree was constructed by Clustalw program (version 1.81) using UPGMA (Unweighted Pair Group Method using Arithmetic averages) algorithm [14]. |
T5099 |
19277-19289 |
JJ |
denotes |
Phylogenetic |
T5100 |
19290-19294 |
NN |
denotes |
tree |
T5102 |
19295-19298 |
VBD |
denotes |
was |
T5101 |
19299-19310 |
VBN |
denotes |
constructed |
T5103 |
19311-19313 |
IN |
denotes |
by |
T5104 |
19314-19322 |
NN |
denotes |
Clustalw |
T5105 |
19323-19330 |
NN |
denotes |
program |
T5106 |
19331-19332 |
-LRB- |
denotes |
( |
T5107 |
19332-19339 |
NN |
denotes |
version |
T5108 |
19340-19344 |
CD |
denotes |
1.81 |
T5109 |
19344-19345 |
-RRB- |
denotes |
) |
T5110 |
19346-19351 |
VBG |
denotes |
using |
T5111 |
19352-19357 |
NN |
denotes |
UPGMA |
T5113 |
19358-19359 |
-LRB- |
denotes |
( |
T5114 |
19359-19369 |
JJ |
denotes |
Unweighted |
T5116 |
19370-19374 |
NN |
denotes |
Pair |
T5117 |
19375-19380 |
NN |
denotes |
Group |
T5115 |
19381-19387 |
NN |
denotes |
Method |
T5118 |
19388-19393 |
VBG |
denotes |
using |
T5119 |
19394-19404 |
NN |
denotes |
Arithmetic |
T5120 |
19405-19413 |
NNS |
denotes |
averages |
T5121 |
19413-19414 |
-RRB- |
denotes |
) |
T5112 |
19415-19424 |
NN |
denotes |
algorithm |
T5122 |
19425-19426 |
-LRB- |
denotes |
[ |
T5123 |
19426-19428 |
CD |
denotes |
14 |
T5124 |
19428-19429 |
-RRB- |
denotes |
] |
T5125 |
19429-19430 |
. |
denotes |
. |
T5264 |
19432-19440 |
JJ |
denotes |
Neuronal |
T5266 |
19441-19445 |
NN |
denotes |
cell |
T5265 |
19446-19457 |
NN |
denotes |
preparation |
T5267 |
19458-19461 |
CC |
denotes |
and |
T5268 |
19462-19477 |
NN |
denotes |
immunostanining |
T5269 |
19477-19547 |
sentence |
denotes |
Hippocampal neuron cultures were prepared as previously reported [6]. |
T5270 |
19478-19489 |
JJ |
denotes |
Hippocampal |
T5272 |
19490-19496 |
NN |
denotes |
neuron |
T5271 |
19497-19505 |
NNS |
denotes |
cultures |
T5274 |
19506-19510 |
VBD |
denotes |
were |
T5273 |
19511-19519 |
VBN |
denotes |
prepared |
T5275 |
19520-19522 |
IN |
denotes |
as |
T5277 |
19523-19533 |
RB |
denotes |
previously |
T5276 |
19534-19542 |
VBN |
denotes |
reported |
T5278 |
19543-19544 |
-LRB- |
denotes |
[ |
T5279 |
19544-19545 |
CD |
denotes |
6 |
T5280 |
19545-19546 |
-RRB- |
denotes |
] |
T5281 |
19546-19547 |
. |
denotes |
. |
T5282 |
19547-19634 |
sentence |
denotes |
In brief, the hippocampuses were dissected out from mouse embryos at 16 days in utero. |
T5283 |
19548-19550 |
IN |
denotes |
In |
T5285 |
19551-19556 |
NN |
denotes |
brief |
T5286 |
19556-19558 |
, |
denotes |
, |
T5287 |
19558-19561 |
DT |
denotes |
the |
T5288 |
19562-19575 |
NNS |
denotes |
hippocampuses |
T5289 |
19576-19580 |
VBD |
denotes |
were |
T5284 |
19581-19590 |
VBN |
denotes |
dissected |
T5290 |
19591-19594 |
RP |
denotes |
out |
T5291 |
19595-19599 |
IN |
denotes |
from |
T5292 |
19600-19605 |
NN |
denotes |
mouse |
T5293 |
19606-19613 |
NNS |
denotes |
embryos |
T5294 |
19614-19616 |
IN |
denotes |
at |
T5295 |
19617-19619 |
CD |
denotes |
16 |
T5296 |
19620-19624 |
NNS |
denotes |
days |
T5297 |
19625-19627 |
FW |
denotes |
in |
T5298 |
19628-19633 |
FW |
denotes |
utero |
T5299 |
19633-19634 |
. |
denotes |
. |
T5300 |
19634-19811 |
sentence |
denotes |
The tissues were then incubated for 20 min at 37°C in MEM (minimum essential medium) modified for suspension culture (Life Technologies) plus 0.25% trypsin (Life Technologies). |
T5301 |
19635-19638 |
DT |
denotes |
The |
T5302 |
19639-19646 |
NNS |
denotes |
tissues |
T5304 |
19647-19651 |
VBD |
denotes |
were |
T5305 |
19652-19656 |
RB |
denotes |
then |
T5303 |
19657-19666 |
VBN |
denotes |
incubated |
T5306 |
19667-19670 |
IN |
denotes |
for |
T5307 |
19671-19673 |
CD |
denotes |
20 |
T5308 |
19674-19677 |
NN |
denotes |
min |
T5309 |
19678-19680 |
IN |
denotes |
at |
T5310 |
19681-19683 |
CD |
denotes |
37 |
T5311 |
19683-19685 |
NN |
denotes |
°C |
T5312 |
19686-19688 |
IN |
denotes |
in |
T5313 |
19689-19692 |
NN |
denotes |
MEM |
T5314 |
19693-19694 |
-LRB- |
denotes |
( |
T5315 |
19694-19701 |
JJ |
denotes |
minimum |
T5317 |
19702-19711 |
JJ |
denotes |
essential |
T5316 |
19712-19718 |
NN |
denotes |
medium |
T5318 |
19718-19719 |
-RRB- |
denotes |
) |
T5319 |
19720-19728 |
VBN |
denotes |
modified |
T5320 |
19729-19732 |
IN |
denotes |
for |
T5321 |
19733-19743 |
NN |
denotes |
suspension |
T5322 |
19744-19751 |
NN |
denotes |
culture |
T5323 |
19752-19753 |
-LRB- |
denotes |
( |
T5325 |
19753-19757 |
NNP |
denotes |
Life |
T5324 |
19758-19770 |
NNP |
denotes |
Technologies |
T5326 |
19770-19771 |
-RRB- |
denotes |
) |
T5327 |
19772-19776 |
CC |
denotes |
plus |
T5328 |
19777-19781 |
CD |
denotes |
0.25 |
T5329 |
19781-19782 |
NN |
denotes |
% |
T5330 |
19783-19790 |
NN |
denotes |
trypsin |
T5331 |
19791-19792 |
-LRB- |
denotes |
( |
T5333 |
19792-19796 |
NNP |
denotes |
Life |
T5332 |
19797-19809 |
NNP |
denotes |
Technologies |
T5334 |
19809-19810 |
-RRB- |
denotes |
) |
T5335 |
19810-19811 |
. |
denotes |
. |
T5336 |
19811-19971 |
sentence |
denotes |
The dissociated hippocampal neurons were plated on glass coverslips coated with a confluent monolayer of mouse cortical astrocytes obtained as described below. |
T5337 |
19812-19815 |
DT |
denotes |
The |
T5339 |
19816-19827 |
JJ |
denotes |
dissociated |
T5340 |
19828-19839 |
JJ |
denotes |
hippocampal |
T5338 |
19840-19847 |
NNS |
denotes |
neurons |
T5342 |
19848-19852 |
VBD |
denotes |
were |
T5341 |
19853-19859 |
VBN |
denotes |
plated |
T5343 |
19860-19862 |
IN |
denotes |
on |
T5344 |
19863-19868 |
NN |
denotes |
glass |
T5345 |
19869-19879 |
NNS |
denotes |
coverslips |
T5346 |
19880-19886 |
VBN |
denotes |
coated |
T5347 |
19887-19891 |
IN |
denotes |
with |
T5348 |
19892-19893 |
DT |
denotes |
a |
T5350 |
19894-19903 |
JJ |
denotes |
confluent |
T5349 |
19904-19913 |
NN |
denotes |
monolayer |
T5351 |
19914-19916 |
IN |
denotes |
of |
T5352 |
19917-19922 |
NN |
denotes |
mouse |
T5354 |
19923-19931 |
JJ |
denotes |
cortical |
T5353 |
19932-19942 |
NNS |
denotes |
astrocytes |
T5355 |
19943-19951 |
VBN |
denotes |
obtained |
T5356 |
19952-19954 |
IN |
denotes |
as |
T5357 |
19955-19964 |
VBN |
denotes |
described |
T5358 |
19965-19970 |
RB |
denotes |
below |
T5359 |
19970-19971 |
. |
denotes |
. |
T5360 |
19971-20047 |
sentence |
denotes |
The neurons were maintained at 37°C in a humidified atmosphere with 5% CO2. |
T5361 |
19972-19975 |
DT |
denotes |
The |
T5362 |
19976-19983 |
NNS |
denotes |
neurons |
T5364 |
19984-19988 |
VBD |
denotes |
were |
T5363 |
19989-19999 |
VBN |
denotes |
maintained |
T5365 |
20000-20002 |
IN |
denotes |
at |
T5366 |
20003-20005 |
CD |
denotes |
37 |
T5367 |
20005-20007 |
NN |
denotes |
°C |
T5368 |
20008-20010 |
IN |
denotes |
in |
T5369 |
20011-20012 |
DT |
denotes |
a |
T5371 |
20013-20023 |
JJ |
denotes |
humidified |
T5370 |
20024-20034 |
NN |
denotes |
atmosphere |
T5372 |
20035-20039 |
IN |
denotes |
with |
T5373 |
20040-20041 |
CD |
denotes |
5 |
T5374 |
20041-20042 |
NN |
denotes |
% |
T5375 |
20043-20046 |
NN |
denotes |
CO2 |
T5376 |
20046-20047 |
. |
denotes |
. |
T5377 |
20047-20200 |
sentence |
denotes |
Cortical astrocytes dissociated from newborn mouse cortices were grown in culture flasks at 37°C in a humidified atmosphere with 5% CO2 until confluent. |
T5378 |
20048-20056 |
JJ |
denotes |
Cortical |
T5379 |
20057-20067 |
NNS |
denotes |
astrocytes |
T5381 |
20068-20079 |
VBN |
denotes |
dissociated |
T5382 |
20080-20084 |
IN |
denotes |
from |
T5383 |
20085-20092 |
JJ |
denotes |
newborn |
T5384 |
20093-20098 |
NN |
denotes |
mouse |
T5385 |
20099-20107 |
NNS |
denotes |
cortices |
T5386 |
20108-20112 |
VBD |
denotes |
were |
T5380 |
20113-20118 |
VBN |
denotes |
grown |
T5387 |
20119-20121 |
IN |
denotes |
in |
T5388 |
20122-20129 |
NN |
denotes |
culture |
T5389 |
20130-20136 |
NNS |
denotes |
flasks |
T5390 |
20137-20139 |
IN |
denotes |
at |
T5391 |
20140-20142 |
CD |
denotes |
37 |
T5392 |
20142-20144 |
NN |
denotes |
°C |
T5393 |
20145-20147 |
IN |
denotes |
in |
T5394 |
20148-20149 |
DT |
denotes |
a |
T5396 |
20150-20160 |
JJ |
denotes |
humidified |
T5395 |
20161-20171 |
NN |
denotes |
atmosphere |
T5397 |
20172-20176 |
IN |
denotes |
with |
T5398 |
20177-20178 |
CD |
denotes |
5 |
T5399 |
20178-20179 |
NN |
denotes |
% |
T5400 |
20180-20183 |
NN |
denotes |
CO2 |
T5401 |
20184-20189 |
IN |
denotes |
until |
T5402 |
20190-20199 |
JJ |
denotes |
confluent |
T5403 |
20199-20200 |
. |
denotes |
. |
T5404 |
20200-20309 |
sentence |
denotes |
The cells were exposed to 10-5 M cytosine arabinoside (Sigma) and cultured for additional 12–24 hrs at 37°C. |
T5405 |
20201-20204 |
DT |
denotes |
The |
T5406 |
20205-20210 |
NNS |
denotes |
cells |
T5408 |
20211-20215 |
VBD |
denotes |
were |
T5407 |
20216-20223 |
VBN |
denotes |
exposed |
T5409 |
20224-20226 |
IN |
denotes |
to |
T5410 |
20227-20229 |
CD |
denotes |
10 |
T5412 |
20229-20230 |
SYM |
denotes |
- |
T5411 |
20230-20231 |
CD |
denotes |
5 |
T5413 |
20232-20233 |
NN |
denotes |
M |
T5415 |
20234-20242 |
NN |
denotes |
cytosine |
T5414 |
20243-20254 |
NN |
denotes |
arabinoside |
T5416 |
20255-20256 |
-LRB- |
denotes |
( |
T5417 |
20256-20261 |
NNP |
denotes |
Sigma |
T5418 |
20261-20262 |
-RRB- |
denotes |
) |
T5419 |
20263-20266 |
CC |
denotes |
and |
T5420 |
20267-20275 |
VBN |
denotes |
cultured |
T5421 |
20276-20279 |
IN |
denotes |
for |
T5422 |
20280-20290 |
JJ |
denotes |
additional |
T5424 |
20291-20293 |
CD |
denotes |
12 |
T5426 |
20293-20294 |
SYM |
denotes |
– |
T5425 |
20294-20296 |
CD |
denotes |
24 |
T5423 |
20297-20300 |
NNS |
denotes |
hrs |
T5427 |
20301-20303 |
IN |
denotes |
at |
T5428 |
20304-20306 |
CD |
denotes |
37 |
T5429 |
20306-20308 |
NN |
denotes |
°C |
T5430 |
20308-20309 |
. |
denotes |
. |
T5431 |
20309-20401 |
sentence |
denotes |
After remove of the media with cellular debris, the cells were used for coating coverslips. |
T5432 |
20310-20315 |
IN |
denotes |
After |
T5434 |
20316-20322 |
NN |
denotes |
remove |
T5435 |
20323-20325 |
IN |
denotes |
of |
T5436 |
20326-20329 |
DT |
denotes |
the |
T5437 |
20330-20335 |
NNS |
denotes |
media |
T5438 |
20336-20340 |
IN |
denotes |
with |
T5439 |
20341-20349 |
JJ |
denotes |
cellular |
T5440 |
20350-20356 |
NN |
denotes |
debris |
T5441 |
20356-20358 |
, |
denotes |
, |
T5442 |
20358-20361 |
DT |
denotes |
the |
T5443 |
20362-20367 |
NNS |
denotes |
cells |
T5444 |
20368-20372 |
VBD |
denotes |
were |
T5433 |
20373-20377 |
VBN |
denotes |
used |
T5445 |
20378-20381 |
IN |
denotes |
for |
T5446 |
20382-20389 |
VBG |
denotes |
coating |
T5447 |
20390-20400 |
NNS |
denotes |
coverslips |
T5448 |
20400-20401 |
. |
denotes |
. |
T5449 |
20401-20623 |
sentence |
denotes |
For immunostaining, neuronal cells on the coverslips were first fixed in PBS containing 4% paraformaldehyde (PFA) for 12 hrs at 4°C and then incubated in a solution containing 4% PFA and 0.4% Triton X-100 at 4°C for 1 hr. |
T5450 |
20402-20405 |
IN |
denotes |
For |
T5452 |
20406-20420 |
NN |
denotes |
immunostaining |
T5453 |
20420-20422 |
, |
denotes |
, |
T5454 |
20422-20430 |
JJ |
denotes |
neuronal |
T5455 |
20431-20436 |
NNS |
denotes |
cells |
T5456 |
20437-20439 |
IN |
denotes |
on |
T5457 |
20440-20443 |
DT |
denotes |
the |
T5458 |
20444-20454 |
NNS |
denotes |
coverslips |
T5459 |
20455-20459 |
VBD |
denotes |
were |
T5460 |
20460-20465 |
RB |
denotes |
first |
T5451 |
20466-20471 |
VBN |
denotes |
fixed |
T5461 |
20472-20474 |
IN |
denotes |
in |
T5462 |
20475-20478 |
NN |
denotes |
PBS |
T5463 |
20479-20489 |
VBG |
denotes |
containing |
T5464 |
20490-20491 |
CD |
denotes |
4 |
T5465 |
20491-20492 |
NN |
denotes |
% |
T5466 |
20493-20509 |
NN |
denotes |
paraformaldehyde |
T5467 |
20510-20511 |
-LRB- |
denotes |
( |
T5468 |
20511-20514 |
NN |
denotes |
PFA |
T5469 |
20514-20515 |
-RRB- |
denotes |
) |
T5470 |
20516-20519 |
IN |
denotes |
for |
T5471 |
20520-20522 |
CD |
denotes |
12 |
T5472 |
20523-20526 |
NNS |
denotes |
hrs |
T5473 |
20527-20529 |
IN |
denotes |
at |
T5474 |
20530-20531 |
CD |
denotes |
4 |
T5475 |
20531-20533 |
NN |
denotes |
°C |
T5476 |
20534-20537 |
CC |
denotes |
and |
T5477 |
20538-20542 |
RB |
denotes |
then |
T5478 |
20543-20552 |
VBN |
denotes |
incubated |
T5479 |
20553-20555 |
IN |
denotes |
in |
T5480 |
20556-20557 |
DT |
denotes |
a |
T5481 |
20558-20566 |
NN |
denotes |
solution |
T5482 |
20567-20577 |
VBG |
denotes |
containing |
T5483 |
20578-20579 |
CD |
denotes |
4 |
T5484 |
20579-20580 |
NN |
denotes |
% |
T5485 |
20581-20584 |
NN |
denotes |
PFA |
T5486 |
20585-20588 |
CC |
denotes |
and |
T5487 |
20589-20592 |
CD |
denotes |
0.4 |
T5488 |
20592-20593 |
NN |
denotes |
% |
T5490 |
20594-20600 |
NN |
denotes |
Triton |
T5491 |
20601-20602 |
NN |
denotes |
X |
T5492 |
20602-20603 |
HYPH |
denotes |
- |
T5489 |
20603-20606 |
NN |
denotes |
100 |
T5493 |
20607-20609 |
IN |
denotes |
at |
T5494 |
20610-20611 |
CD |
denotes |
4 |
T5495 |
20611-20613 |
NN |
denotes |
°C |
T5496 |
20614-20617 |
IN |
denotes |
for |
T5497 |
20618-20619 |
CD |
denotes |
1 |
T5498 |
20620-20622 |
NN |
denotes |
hr |
T5499 |
20622-20623 |
. |
denotes |
. |
T5500 |
20623-20842 |
sentence |
denotes |
After washing with PBS three times, the cells were incubated with a blocking solution containing 1:30 normal goat serum, and subsequently incubated with a rabbit polyclonal anti-ACDP antibody (1:3000) overnight at 4°C. |
T5501 |
20624-20629 |
IN |
denotes |
After |
T5503 |
20630-20637 |
VBG |
denotes |
washing |
T5504 |
20638-20642 |
IN |
denotes |
with |
T5505 |
20643-20646 |
NN |
denotes |
PBS |
T5506 |
20647-20652 |
CD |
denotes |
three |
T5507 |
20653-20658 |
NNS |
denotes |
times |
T5508 |
20658-20660 |
, |
denotes |
, |
T5509 |
20660-20663 |
DT |
denotes |
the |
T5510 |
20664-20669 |
NNS |
denotes |
cells |
T5511 |
20670-20674 |
VBD |
denotes |
were |
T5502 |
20675-20684 |
VBN |
denotes |
incubated |
T5512 |
20685-20689 |
IN |
denotes |
with |
T5513 |
20690-20691 |
DT |
denotes |
a |
T5515 |
20692-20700 |
VBG |
denotes |
blocking |
T5514 |
20701-20709 |
NN |
denotes |
solution |
T5516 |
20710-20720 |
VBG |
denotes |
containing |
T5517 |
20721-20722 |
CD |
denotes |
1 |
T5519 |
20722-20723 |
SYM |
denotes |
: |
T5520 |
20723-20725 |
CD |
denotes |
30 |
T5521 |
20726-20732 |
JJ |
denotes |
normal |
T5522 |
20733-20737 |
NN |
denotes |
goat |
T5518 |
20738-20743 |
NN |
denotes |
serum |
T5523 |
20743-20745 |
, |
denotes |
, |
T5524 |
20745-20748 |
CC |
denotes |
and |
T5525 |
20749-20761 |
RB |
denotes |
subsequently |
T5526 |
20762-20771 |
VBN |
denotes |
incubated |
T5527 |
20772-20776 |
IN |
denotes |
with |
T5528 |
20777-20778 |
DT |
denotes |
a |
T5530 |
20779-20785 |
NN |
denotes |
rabbit |
T5531 |
20786-20796 |
JJ |
denotes |
polyclonal |
T5532 |
20797-20806 |
JJ |
denotes |
anti-ACDP |
T5529 |
20807-20815 |
NN |
denotes |
antibody |
T5533 |
20816-20817 |
-LRB- |
denotes |
( |
T5534 |
20817-20818 |
CD |
denotes |
1 |
T5535 |
20818-20819 |
SYM |
denotes |
: |
T5536 |
20819-20823 |
CD |
denotes |
3000 |
T5537 |
20823-20824 |
-RRB- |
denotes |
) |
T5538 |
20825-20834 |
RB |
denotes |
overnight |
T5539 |
20835-20837 |
IN |
denotes |
at |
T5540 |
20838-20839 |
CD |
denotes |
4 |
T5541 |
20839-20841 |
NN |
denotes |
°C |
T5542 |
20841-20842 |
. |
denotes |
. |
T5543 |
20842-21058 |
sentence |
denotes |
After extensive washing with 1% goat serum PBS solution, the cells were incubated with an Alex 488 conjugated secondary antibody (1:100 in 1% goat serum PBS solution, Molecular Probes) for 3 hrs at room temperature. |
T5544 |
20843-20848 |
IN |
denotes |
After |
T5546 |
20849-20858 |
JJ |
denotes |
extensive |
T5547 |
20859-20866 |
NN |
denotes |
washing |
T5548 |
20867-20871 |
IN |
denotes |
with |
T5549 |
20872-20873 |
CD |
denotes |
1 |
T5550 |
20873-20874 |
NN |
denotes |
% |
T5552 |
20875-20879 |
NN |
denotes |
goat |
T5551 |
20880-20885 |
NN |
denotes |
serum |
T5554 |
20886-20889 |
NN |
denotes |
PBS |
T5553 |
20890-20898 |
NN |
denotes |
solution |
T5555 |
20898-20900 |
, |
denotes |
, |
T5556 |
20900-20903 |
DT |
denotes |
the |
T5557 |
20904-20909 |
NNS |
denotes |
cells |
T5558 |
20910-20914 |
VBD |
denotes |
were |
T5545 |
20915-20924 |
VBN |
denotes |
incubated |
T5559 |
20925-20929 |
IN |
denotes |
with |
T5560 |
20930-20932 |
DT |
denotes |
an |
T5562 |
20933-20937 |
NNP |
denotes |
Alex |
T5563 |
20938-20941 |
CD |
denotes |
488 |
T5564 |
20942-20952 |
JJ |
denotes |
conjugated |
T5565 |
20953-20962 |
JJ |
denotes |
secondary |
T5561 |
20963-20971 |
NN |
denotes |
antibody |
T5566 |
20972-20973 |
-LRB- |
denotes |
( |
T5568 |
20973-20974 |
CD |
denotes |
1 |
T5569 |
20974-20975 |
SYM |
denotes |
: |
T5570 |
20975-20978 |
CD |
denotes |
100 |
T5571 |
20979-20981 |
IN |
denotes |
in |
T5572 |
20982-20983 |
CD |
denotes |
1 |
T5573 |
20983-20984 |
NN |
denotes |
% |
T5575 |
20985-20989 |
NN |
denotes |
goat |
T5574 |
20990-20995 |
NN |
denotes |
serum |
T5577 |
20996-20999 |
NN |
denotes |
PBS |
T5576 |
21000-21008 |
NN |
denotes |
solution |
T5578 |
21008-21010 |
, |
denotes |
, |
T5579 |
21010-21019 |
NNP |
denotes |
Molecular |
T5567 |
21020-21026 |
NNP |
denotes |
Probes |
T5580 |
21026-21027 |
-RRB- |
denotes |
) |
T5581 |
21028-21031 |
IN |
denotes |
for |
T5582 |
21032-21033 |
CD |
denotes |
3 |
T5583 |
21034-21037 |
NNS |
denotes |
hrs |
T5584 |
21038-21040 |
IN |
denotes |
at |
T5585 |
21041-21045 |
NN |
denotes |
room |
T5586 |
21046-21057 |
NN |
denotes |
temperature |
T5587 |
21057-21058 |
. |
denotes |
. |
T5588 |
21058-21217 |
sentence |
denotes |
Following final washes with 1% goat serum PBS solution, the neuronal cells on the coverslips were cover-slipped with a glycerol-based anti-photobleach medium. |
T5589 |
21059-21068 |
IN |
denotes |
Following |
T5591 |
21069-21074 |
JJ |
denotes |
final |
T5592 |
21075-21081 |
NNS |
denotes |
washes |
T5593 |
21082-21086 |
IN |
denotes |
with |
T5594 |
21087-21088 |
CD |
denotes |
1 |
T5595 |
21088-21089 |
NN |
denotes |
% |
T5597 |
21090-21094 |
NN |
denotes |
goat |
T5596 |
21095-21100 |
NN |
denotes |
serum |
T5599 |
21101-21104 |
NN |
denotes |
PBS |
T5598 |
21105-21113 |
NN |
denotes |
solution |
T5600 |
21113-21115 |
, |
denotes |
, |
T5601 |
21115-21118 |
DT |
denotes |
the |
T5603 |
21119-21127 |
JJ |
denotes |
neuronal |
T5602 |
21128-21133 |
NNS |
denotes |
cells |
T5604 |
21134-21136 |
IN |
denotes |
on |
T5605 |
21137-21140 |
DT |
denotes |
the |
T5606 |
21141-21151 |
NNS |
denotes |
coverslips |
T5607 |
21152-21156 |
VBD |
denotes |
were |
T5608 |
21157-21162 |
NN |
denotes |
cover |
T5609 |
21162-21163 |
HYPH |
denotes |
- |
T5590 |
21163-21170 |
VBN |
denotes |
slipped |
T5610 |
21171-21175 |
IN |
denotes |
with |
T5611 |
21176-21177 |
DT |
denotes |
a |
T5613 |
21178-21186 |
NN |
denotes |
glycerol |
T5615 |
21186-21187 |
HYPH |
denotes |
- |
T5614 |
21187-21192 |
VBN |
denotes |
based |
T5616 |
21193-21209 |
JJ |
denotes |
anti-photobleach |
T5612 |
21210-21216 |
NN |
denotes |
medium |
T5617 |
21216-21217 |
. |
denotes |
. |
T5618 |
21217-21281 |
sentence |
denotes |
The cells were viewed under a confocal microscope (Carl Zeiss). |
T5619 |
21218-21221 |
DT |
denotes |
The |
T5620 |
21222-21227 |
NNS |
denotes |
cells |
T5622 |
21228-21232 |
VBD |
denotes |
were |
T5621 |
21233-21239 |
VBN |
denotes |
viewed |
T5623 |
21240-21245 |
IN |
denotes |
under |
T5624 |
21246-21247 |
DT |
denotes |
a |
T5626 |
21248-21256 |
JJ |
denotes |
confocal |
T5625 |
21257-21267 |
NN |
denotes |
microscope |
T5627 |
21268-21269 |
-LRB- |
denotes |
( |
T5629 |
21269-21273 |
NNP |
denotes |
Carl |
T5628 |
21274-21279 |
NNP |
denotes |
Zeiss |
T5630 |
21279-21280 |
-RRB- |
denotes |
) |
T5631 |
21280-21281 |
. |
denotes |
. |
T5632 |
21281-21397 |
sentence |
denotes |
Images were captured with a CCD camera and acquired by the Scion Image software (Scion Corporation, Frederick, MD). |
T5633 |
21282-21288 |
NNS |
denotes |
Images |
T5635 |
21289-21293 |
VBD |
denotes |
were |
T5634 |
21294-21302 |
VBN |
denotes |
captured |
T5636 |
21303-21307 |
IN |
denotes |
with |
T5637 |
21308-21309 |
DT |
denotes |
a |
T5639 |
21310-21313 |
NN |
denotes |
CCD |
T5638 |
21314-21320 |
NN |
denotes |
camera |
T5640 |
21321-21324 |
CC |
denotes |
and |
T5641 |
21325-21333 |
VBN |
denotes |
acquired |
T5642 |
21334-21336 |
IN |
denotes |
by |
T5643 |
21337-21340 |
DT |
denotes |
the |
T5645 |
21341-21346 |
NNP |
denotes |
Scion |
T5646 |
21347-21352 |
NN |
denotes |
Image |
T5644 |
21353-21361 |
NN |
denotes |
software |
T5647 |
21362-21363 |
-LRB- |
denotes |
( |
T5649 |
21363-21368 |
NNP |
denotes |
Scion |
T5648 |
21369-21380 |
NNP |
denotes |
Corporation |
T5650 |
21380-21382 |
, |
denotes |
, |
T5651 |
21382-21391 |
NNP |
denotes |
Frederick |
T5652 |
21391-21393 |
, |
denotes |
, |
T5653 |
21393-21395 |
NNP |
denotes |
MD |
T5654 |
21395-21396 |
-RRB- |
denotes |
) |
T5655 |
21396-21397 |
. |
denotes |
. |
T5677 |
21399-21403 |
NN |
denotes |
Gene |
T5678 |
21404-21408 |
NN |
denotes |
bank |
T5680 |
21409-21418 |
NN |
denotes |
accession |
T5679 |
21419-21425 |
NN |
denotes |
number |
T5681 |
21425-21608 |
sentence |
denotes |
The cDNA sequences for the Acdp gene family have already been deposited in gene bank with accession numbers AF202994 (Acdp1), AF216961 (Acdp2), AF216964 (Acdp3) and AF216963 (Acdp4). |
T5682 |
21426-21429 |
DT |
denotes |
The |
T5684 |
21430-21434 |
NN |
denotes |
cDNA |
T5683 |
21435-21444 |
NNS |
denotes |
sequences |
T5686 |
21445-21448 |
IN |
denotes |
for |
T5687 |
21449-21452 |
DT |
denotes |
the |
T5689 |
21453-21457 |
NN |
denotes |
Acdp |
T5690 |
21458-21462 |
NN |
denotes |
gene |
T5688 |
21463-21469 |
NN |
denotes |
family |
T5691 |
21470-21474 |
VBP |
denotes |
have |
T5692 |
21475-21482 |
RB |
denotes |
already |
T5693 |
21483-21487 |
VBN |
denotes |
been |
T5685 |
21488-21497 |
VBN |
denotes |
deposited |
T5694 |
21498-21500 |
IN |
denotes |
in |
T5695 |
21501-21505 |
NN |
denotes |
gene |
T5696 |
21506-21510 |
NN |
denotes |
bank |
T5697 |
21511-21515 |
IN |
denotes |
with |
T5698 |
21516-21525 |
NN |
denotes |
accession |
T5700 |
21526-21533 |
NNS |
denotes |
numbers |
T5699 |
21534-21542 |
NN |
denotes |
AF202994 |
T5701 |
21543-21544 |
-LRB- |
denotes |
( |
T5702 |
21544-21549 |
NN |
denotes |
Acdp1 |
T5703 |
21549-21550 |
-RRB- |
denotes |
) |
T5704 |
21550-21552 |
, |
denotes |
, |
T5705 |
21552-21560 |
NN |
denotes |
AF216961 |
T5706 |
21561-21562 |
-LRB- |
denotes |
( |
T5707 |
21562-21567 |
NN |
denotes |
Acdp2 |
T5708 |
21567-21568 |
-RRB- |
denotes |
) |
T5709 |
21568-21570 |
, |
denotes |
, |
T5710 |
21570-21578 |
NN |
denotes |
AF216964 |
T5711 |
21579-21580 |
-LRB- |
denotes |
( |
T5712 |
21580-21585 |
NN |
denotes |
Acdp3 |
T5713 |
21585-21586 |
-RRB- |
denotes |
) |
T5714 |
21587-21590 |
CC |
denotes |
and |
T5715 |
21591-21599 |
NN |
denotes |
AF216963 |
T5716 |
21600-21601 |
-LRB- |
denotes |
( |
T5717 |
21601-21606 |
NN |
denotes |
Acdp4 |
T5718 |
21606-21607 |
-RRB- |
denotes |
) |
T5719 |
21607-21608 |
. |
denotes |
. |
R1000 |
T2035 |
T2036 |
nmod |
nucleotide,sequences |
R1001 |
T2036 |
T2033 |
pobj |
sequences,of |
R1002 |
T2037 |
T2035 |
cc |
and,nucleotide |
R1003 |
T2038 |
T2035 |
conj |
AA,nucleotide |
R1004 |
T2039 |
T2032 |
prep |
to,homologies |
R1005 |
T2040 |
T2041 |
det |
the,genes |
R1006 |
T2041 |
T2039 |
pobj |
genes,to |
R1007 |
T2042 |
T2041 |
amod |
human,genes |
R1008 |
T2043 |
T2041 |
compound |
ACDP,genes |
R1009 |
T2044 |
T2045 |
punct |
(,Table |
R1010 |
T2045 |
T2029 |
parataxis |
Table,showed |
R1011 |
T2046 |
T2045 |
nummod |
1,Table |
R1012 |
T2047 |
T2045 |
punct |
),Table |
R1013 |
T2048 |
T2029 |
punct |
.,showed |
R1014 |
T2050 |
T2051 |
det |
The,homologies |
R1015 |
T2051 |
T2053 |
nsubjpass |
homologies,observed |
R1016 |
T2052 |
T2051 |
amod |
highest,homologies |
R1017 |
T2054 |
T2053 |
auxpass |
were,observed |
R1018 |
T2055 |
T2053 |
prep |
between,observed |
R1019 |
T2056 |
T2057 |
det |
the,ACDP2 |
R1020 |
T2057 |
T2055 |
pobj |
ACDP2,between |
R1021 |
T2058 |
T2057 |
amod |
human,ACDP2 |
R1022 |
T2059 |
T2057 |
cc |
and,ACDP2 |
R1023 |
T2060 |
T2061 |
det |
the,Acdp2 |
R1024 |
T2061 |
T2063 |
compound |
Acdp2,gene |
R1025 |
T2062 |
T2061 |
compound |
mouse,Acdp2 |
R1026 |
T2063 |
T2057 |
conj |
gene,ACDP2 |
R1027 |
T2064 |
T2065 |
punct |
(,% |
R1028 |
T2065 |
T2053 |
parataxis |
%,observed |
R1029 |
T2066 |
T2065 |
nummod |
91,% |
R1030 |
T2067 |
T2065 |
prep |
of,% |
R1031 |
T2068 |
T2069 |
compound |
nucleotide,identity |
R1032 |
T2069 |
T2067 |
pobj |
identity,of |
R1033 |
T2070 |
T2065 |
punct |
", ",% |
R1034 |
T2071 |
T2072 |
nummod |
97,% |
R1035 |
T2072 |
T2065 |
conj |
%,% |
R1036 |
T2073 |
T2072 |
prep |
of,% |
R1037 |
T2074 |
T2075 |
compound |
AA,identity |
R1038 |
T2075 |
T2073 |
pobj |
identity,of |
R1039 |
T2076 |
T2072 |
cc |
and,% |
R1040 |
T2077 |
T2078 |
nummod |
99.4,% |
R1041 |
T2078 |
T2072 |
conj |
%,% |
R1042 |
T2079 |
T2078 |
prep |
of,% |
R1043 |
T2080 |
T2081 |
compound |
AA,homology |
R1044 |
T2081 |
T2079 |
pobj |
homology,of |
R1045 |
T2082 |
T2065 |
punct |
),% |
R1046 |
T2083 |
T2053 |
punct |
.,observed |
R1047 |
T2085 |
T2086 |
prep |
In,showed |
R1048 |
T2086 |
T2105 |
ccomp |
showed,showed |
R1049 |
T2087 |
T2085 |
pobj |
addition,In |
R1050 |
T2088 |
T2086 |
punct |
", ",showed |
R1051 |
T2089 |
T2090 |
det |
the,sequences |
R1052 |
T2090 |
T2086 |
nsubj |
sequences,showed |
R1053 |
T2091 |
T2092 |
nummod |
5,UTR |
R1054 |
T2092 |
T2090 |
compound |
UTR,sequences |
R1055 |
T2093 |
T2091 |
punct |
',5 |
R1056 |
T2094 |
T2090 |
compound |
nucleotide,sequences |
R1057 |
T2095 |
T2096 |
punct |
(,bp |
R1058 |
T2096 |
T2090 |
parataxis |
bp,sequences |
R1059 |
T2097 |
T2096 |
nummod |
20,bp |
R1060 |
T2098 |
T2096 |
prep |
of,bp |
R1061 |
T2099 |
T2098 |
pobj |
nucleotides,of |
R1062 |
T2100 |
T2096 |
prep |
before,bp |
R1063 |
T2101 |
T2102 |
compound |
start,codon |
R1064 |
T2102 |
T2100 |
pobj |
codon,before |
R1065 |
T2103 |
T2096 |
punct |
),bp |
R1066 |
T2104 |
T2086 |
advmod |
also,showed |
R1067 |
T2106 |
T2107 |
amod |
high,homologies |
R1068 |
T2107 |
T2086 |
dobj |
homologies,showed |
R1069 |
T2108 |
T2107 |
prep |
to,homologies |
R1070 |
T2109 |
T2110 |
det |
the,homologs |
R1071 |
T2110 |
T2108 |
pobj |
homologs,to |
R1072 |
T2111 |
T2110 |
amod |
human,homologs |
R1073 |
T2112 |
T2105 |
punct |
", ",showed |
R1074 |
T2113 |
T2105 |
prep |
for,showed |
R1075 |
T2114 |
T2113 |
pobj |
example,for |
R1076 |
T2115 |
T2105 |
punct |
", ",showed |
R1077 |
T2116 |
T2117 |
det |
the,sequence |
R1078 |
T2117 |
T2105 |
nsubj |
sequence,showed |
R1079 |
T2118 |
T2117 |
nmod |
Acdp2,sequence |
R1080 |
T2119 |
T2120 |
nummod |
5,UTR |
R1081 |
T2120 |
T2117 |
compound |
UTR,sequence |
R1082 |
T2121 |
T2119 |
punct |
',5 |
R1083 |
T2122 |
T2123 |
nummod |
95,% |
R1084 |
T2123 |
T2124 |
compound |
%,identities |
R1085 |
T2124 |
T2105 |
dobj |
identities,showed |
R1086 |
T2125 |
T2105 |
prep |
to,showed |
R1087 |
T2126 |
T2127 |
poss |
its,homolog |
R1088 |
T2127 |
T2125 |
pobj |
homolog,to |
R1089 |
T2128 |
T2127 |
amod |
human,homolog |
R1090 |
T2129 |
T2105 |
punct |
.,showed |
R1091 |
T2131 |
T2132 |
advmod |
However,were |
R1092 |
T2133 |
T2132 |
punct |
", ",were |
R1093 |
T2134 |
T2135 |
det |
the,homologies |
R1094 |
T2135 |
T2132 |
nsubj |
homologies,were |
R1095 |
T2136 |
T2135 |
prep |
in,homologies |
R1096 |
T2137 |
T2138 |
det |
the,sequences |
R1097 |
T2138 |
T2136 |
pobj |
sequences,in |
R1098 |
T2139 |
T2140 |
nummod |
3,UTR |
R1099 |
T2140 |
T2138 |
compound |
UTR,sequences |
R1100 |
T2141 |
T2139 |
punct |
',3 |
R1101 |
T2142 |
T2143 |
punct |
(,bp |
R1102 |
T2143 |
T2135 |
parataxis |
bp,homologies |
R1103 |
T2144 |
T2143 |
nummod |
20,bp |
R1104 |
T2145 |
T2143 |
prep |
of,bp |
R1105 |
T2146 |
T2145 |
pobj |
nucleotides,of |
R1106 |
T2147 |
T2143 |
prep |
after,bp |
R1107 |
T2148 |
T2149 |
compound |
stop,codon |
R1108 |
T2149 |
T2147 |
pobj |
codon,after |
R1109 |
T2150 |
T2143 |
punct |
),bp |
R1110 |
T2151 |
T2152 |
advmod |
much,lower |
R1111 |
T2152 |
T2132 |
acomp |
lower,were |
R1112 |
T2153 |
T2154 |
punct |
(,% |
R1113 |
T2154 |
T2132 |
parataxis |
%,were |
R1114 |
T2155 |
T2156 |
quantmod |
40,55 |
R1115 |
T2156 |
T2154 |
nummod |
55,% |
R1116 |
T2157 |
T2156 |
punct |
–,55 |
R1117 |
T2158 |
T2154 |
punct |
),% |
R1118 |
T2159 |
T2132 |
prep |
for,were |
R1119 |
T2160 |
T2161 |
det |
all,genes |
R1120 |
T2161 |
T2159 |
pobj |
genes,for |
R1121 |
T2162 |
T2161 |
compound |
Acdp,genes |
R1122 |
T2163 |
T2161 |
prep |
except,genes |
R1123 |
T2164 |
T2163 |
pobj |
Acdp4,except |
R1124 |
T2165 |
T2166 |
punct |
(,identity |
R1125 |
T2166 |
T2164 |
parataxis |
identity,Acdp4 |
R1126 |
T2167 |
T2166 |
nummod |
90,identity |
R1127 |
T2168 |
T2167 |
quantmod |
%,90 |
R1128 |
T2169 |
T2166 |
prep |
to,identity |
R1129 |
T2170 |
T2171 |
poss |
its,homolog |
R1130 |
T2171 |
T2169 |
pobj |
homolog,to |
R1131 |
T2172 |
T2171 |
amod |
human,homolog |
R1132 |
T2173 |
T2166 |
punct |
),identity |
R1133 |
T2174 |
T2132 |
punct |
.,were |
R1134 |
T2176 |
T2177 |
det |
The,domain |
R1135 |
T2177 |
T2180 |
nsubj |
domain,has |
R1136 |
T2178 |
T2177 |
amod |
ancient,domain |
R1137 |
T2179 |
T2177 |
amod |
conserved,domain |
R1138 |
T2181 |
T2177 |
punct |
(,domain |
R1139 |
T2182 |
T2177 |
appos |
ACD,domain |
R1140 |
T2183 |
T2180 |
punct |
),has |
R1141 |
T2184 |
T2185 |
nummod |
55.3,% |
R1142 |
T2185 |
T2180 |
dobj |
%,has |
R1143 |
T2186 |
T2185 |
prep |
of,% |
R1144 |
T2187 |
T2188 |
compound |
AA,identity |
R1145 |
T2188 |
T2186 |
pobj |
identity,of |
R1146 |
T2189 |
T2185 |
cc |
and,% |
R1147 |
T2190 |
T2191 |
nummod |
83.3,% |
R1148 |
T2191 |
T2185 |
conj |
%,% |
R1149 |
T2192 |
T2191 |
prep |
of,% |
R1150 |
T2193 |
T2192 |
pobj |
homology,of |
R1151 |
T2194 |
T2180 |
prep |
between,has |
R1152 |
T2195 |
T2196 |
det |
all,proteins |
R1153 |
T2196 |
T2194 |
pobj |
proteins,between |
R1154 |
T2197 |
T2196 |
nmod |
mouse,proteins |
R1155 |
T2198 |
T2197 |
cc |
and,mouse |
R1156 |
T2199 |
T2197 |
conj |
human,mouse |
R1157 |
T2200 |
T2196 |
compound |
ACDP,proteins |
R1158 |
T2201 |
T2202 |
punct |
(,Fig. |
R1159 |
T2202 |
T2180 |
parataxis |
Fig.,has |
R1160 |
T2203 |
T2202 |
nummod |
2,Fig. |
R1161 |
T2204 |
T2202 |
punct |
),Fig. |
R1162 |
T2205 |
T2180 |
punct |
.,has |
R1163 |
T2207 |
T2208 |
det |
The,domain |
R1164 |
T2208 |
T2210 |
nsubjpass |
domain,conserved |
R1165 |
T2209 |
T2208 |
compound |
ACD,domain |
R1166 |
T2211 |
T2210 |
auxpass |
is,conserved |
R1167 |
T2212 |
T2210 |
advmod |
evolutionarily,conserved |
R1168 |
T2213 |
T2210 |
prep |
in,conserved |
R1169 |
T2214 |
T2215 |
amod |
divergent,species |
R1170 |
T2215 |
T2213 |
pobj |
species,in |
R1171 |
T2216 |
T2215 |
acl |
ranging,species |
R1172 |
T2217 |
T2216 |
prep |
from,ranging |
R1173 |
T2218 |
T2217 |
pobj |
bacteria,from |
R1174 |
T2219 |
T2218 |
punct |
", ",bacteria |
R1175 |
T2220 |
T2218 |
appos |
yeast,bacteria |
R1176 |
T2221 |
T2218 |
punct |
", ",bacteria |
R1177 |
T2222 |
T2223 |
compound |
C.,elegans |
R1178 |
T2223 |
T2218 |
appos |
elegans,bacteria |
R1179 |
T2224 |
T2218 |
punct |
", ",bacteria |
R1180 |
T2225 |
T2226 |
compound |
D.,melanogaster |
R1181 |
T2226 |
T2218 |
appos |
melanogaster,bacteria |
R1182 |
T2227 |
T2218 |
punct |
", ",bacteria |
R1183 |
T2228 |
T2218 |
appos |
mouse,bacteria |
R1184 |
T2229 |
T2217 |
prep |
to,from |
R1185 |
T2230 |
T2229 |
pobj |
human,to |
R1186 |
T2231 |
T2232 |
punct |
(,Fig. |
R1187 |
T2232 |
T2210 |
parataxis |
Fig.,conserved |
R1188 |
T2233 |
T2232 |
nummod |
3,Fig. |
R1189 |
T2234 |
T2232 |
punct |
),Fig. |
R1190 |
T2235 |
T2210 |
punct |
.,conserved |
R1191 |
T2237 |
T2238 |
advmod |
Particularly,showed |
R1192 |
T2239 |
T2238 |
punct |
", ",showed |
R1193 |
T2240 |
T2241 |
mark |
as,shown |
R1194 |
T2241 |
T2238 |
advcl |
shown,showed |
R1195 |
T2242 |
T2241 |
prep |
in,shown |
R1196 |
T2243 |
T2242 |
pobj |
Fig.,in |
R1197 |
T2244 |
T2243 |
nummod |
3,Fig. |
R1198 |
T2245 |
T2238 |
punct |
", ",showed |
R1199 |
T2246 |
T2247 |
compound |
Acdp,proteins |
R1200 |
T2247 |
T2238 |
nsubj |
proteins,showed |
R1201 |
T2248 |
T2249 |
advmod |
very,strong |
R1202 |
T2249 |
T2250 |
amod |
strong,homology |
R1203 |
T2250 |
T2238 |
dobj |
homology,showed |
R1204 |
T2251 |
T2250 |
compound |
AA,homology |
R1205 |
T2252 |
T2250 |
prep |
to,homology |
R1206 |
T2253 |
T2254 |
compound |
bacteria,protein |
R1207 |
T2254 |
T2252 |
pobj |
protein,to |
R1208 |
T2255 |
T2254 |
compound |
CorC,protein |
R1209 |
T2256 |
T2257 |
punct |
(,identity |
R1210 |
T2257 |
T2254 |
parataxis |
identity,protein |
R1211 |
T2258 |
T2259 |
nummod |
35,% |
R1212 |
T2259 |
T2257 |
compound |
%,identity |
R1213 |
T2260 |
T2257 |
compound |
AA,identity |
R1214 |
T2261 |
T2257 |
prep |
with,identity |
R1215 |
T2262 |
T2263 |
nummod |
55,% |
R1216 |
T2263 |
T2264 |
compound |
%,homology |
R1217 |
T2264 |
T2261 |
pobj |
homology,with |
R1218 |
T2265 |
T2257 |
punct |
),identity |
R1219 |
T2266 |
T2254 |
punct |
", ",protein |
R1220 |
T2267 |
T2268 |
dep |
which,involved |
R1221 |
T2268 |
T2254 |
relcl |
involved,protein |
R1222 |
T2269 |
T2268 |
auxpass |
is,involved |
R1223 |
T2270 |
T2268 |
prep |
in,involved |
R1224 |
T2271 |
T2272 |
nmod |
magnesium,efflux |
R1225 |
T2272 |
T2270 |
pobj |
efflux,in |
R1226 |
T2273 |
T2271 |
cc |
and,magnesium |
R1227 |
T2274 |
T2271 |
conj |
cobalt,magnesium |
R1228 |
T2275 |
T2276 |
punct |
[,7 |
R1229 |
T2276 |
T2238 |
parataxis |
7,showed |
R1230 |
T2277 |
T2276 |
punct |
],7 |
R1231 |
T2278 |
T2238 |
punct |
.,showed |
R1232 |
T2280 |
T2281 |
amod |
High,homology |
R1233 |
T2281 |
T2283 |
nsubjpass |
homology,observed |
R1234 |
T2282 |
T2281 |
compound |
AA,homology |
R1235 |
T2284 |
T2283 |
auxpass |
was,observed |
R1236 |
T2285 |
T2283 |
advmod |
also,observed |
R1237 |
T2286 |
T2283 |
prep |
between,observed |
R1238 |
T2287 |
T2288 |
det |
the,proteins |
R1239 |
T2288 |
T2286 |
pobj |
proteins,between |
R1240 |
T2289 |
T2288 |
compound |
Acdp,proteins |
R1241 |
T2290 |
T2288 |
cc |
and,proteins |
R1242 |
T2291 |
T2292 |
det |
the,protein |
R1243 |
T2292 |
T2288 |
conj |
protein,proteins |
R1244 |
T2293 |
T2292 |
compound |
yeast,protein |
R1245 |
T2294 |
T2292 |
compound |
Amip3,protein |
R1246 |
T2295 |
T2296 |
punct |
(,identity |
R1247 |
T2296 |
T2283 |
parataxis |
identity,observed |
R1248 |
T2297 |
T2296 |
nummod |
35,identity |
R1249 |
T2298 |
T2297 |
quantmod |
%,35 |
R1250 |
T2299 |
T2296 |
compound |
AA,identity |
R1251 |
T2300 |
T2296 |
prep |
with,identity |
R1252 |
T2301 |
T2302 |
nummod |
56,homology |
R1253 |
T2302 |
T2300 |
pobj |
homology,with |
R1254 |
T2303 |
T2301 |
quantmod |
%,56 |
R1255 |
T2304 |
T2296 |
punct |
),identity |
R1256 |
T2305 |
T2283 |
punct |
.,observed |
R1257 |
T2307 |
T2308 |
det |
The,Amip3 |
R1258 |
T2308 |
T2309 |
nsubj |
Amip3,is |
R1259 |
T2310 |
T2309 |
acomp |
likely,is |
R1260 |
T2311 |
T2312 |
aux |
to,be |
R1261 |
T2312 |
T2310 |
xcomp |
be,likely |
R1262 |
T2313 |
T2314 |
det |
a,homologous |
R1263 |
T2314 |
T2312 |
attr |
homologous,be |
R1264 |
T2315 |
T2314 |
prep |
to,homologous |
R1265 |
T2316 |
T2317 |
det |
the,protein |
R1266 |
T2317 |
T2315 |
pobj |
protein,to |
R1267 |
T2318 |
T2317 |
compound |
bacteria,protein |
R1268 |
T2319 |
T2317 |
compound |
CorC,protein |
R1269 |
T2320 |
T2309 |
punct |
.,is |
R1270 |
T2322 |
T2323 |
det |
The,mutants |
R1271 |
T2323 |
T2325 |
nsubj |
mutants,confer |
R1272 |
T2324 |
T2323 |
compound |
Amip3,mutants |
R1273 |
T2326 |
T2325 |
dobj |
resistance,confer |
R1274 |
T2327 |
T2326 |
prep |
to,resistance |
R1275 |
T2328 |
T2329 |
compound |
copper,toxicity |
R1276 |
T2329 |
T2327 |
pobj |
toxicity,to |
R1277 |
T2330 |
T2331 |
punct |
(,Dr. |
R1278 |
T2331 |
T2325 |
meta |
Dr.,confer |
R1279 |
T2332 |
T2331 |
amod |
Personal,Dr. |
R1280 |
T2333 |
T2331 |
nmod |
communication,Dr. |
R1281 |
T2334 |
T2331 |
nmod |
with,Dr. |
R1282 |
T2335 |
T2331 |
nmod |
V.C.,Dr. |
R1283 |
T2336 |
T2331 |
nmod |
Culotte,Dr. |
R1284 |
T2337 |
T2331 |
punct |
", ",Dr. |
R1285 |
T2338 |
T2331 |
nmod |
John,Dr. |
R1286 |
T2339 |
T2331 |
nmod |
Hopkins,Dr. |
R1287 |
T2340 |
T2331 |
nmod |
Bloomberg,Dr. |
R1288 |
T2341 |
T2331 |
punct |
", ",Dr. |
R1289 |
T2342 |
T2331 |
nmod |
School,Dr. |
R1290 |
T2343 |
T2331 |
nmod |
of,Dr. |
R1291 |
T2344 |
T2331 |
nmod |
Public,Dr. |
R1292 |
T2345 |
T2331 |
nmod |
Health,Dr. |
R1293 |
T2346 |
T2331 |
punct |
),Dr. |
R1294 |
T2347 |
T2325 |
punct |
.,confer |
R1295 |
T2349 |
T2350 |
det |
The,relationships |
R1296 |
T2350 |
T2352 |
nsubjpass |
relationships,illustrated |
R1297 |
T2351 |
T2350 |
amod |
evolutionary,relationships |
R1298 |
T2353 |
T2350 |
prep |
among,relationships |
R1299 |
T2354 |
T2355 |
det |
those,proteins |
R1300 |
T2355 |
T2353 |
pobj |
proteins,among |
R1301 |
T2356 |
T2352 |
auxpass |
are,illustrated |
R1302 |
T2357 |
T2352 |
prep |
by,illustrated |
R1303 |
T2358 |
T2359 |
det |
a,tree |
R1304 |
T2359 |
T2357 |
pobj |
tree,by |
R1305 |
T2360 |
T2359 |
amod |
phylogenetic,tree |
R1306 |
T2361 |
T2359 |
acl |
constructed,tree |
R1307 |
T2362 |
T2361 |
prep |
based,constructed |
R1308 |
T2363 |
T2362 |
prep |
on,based |
R1309 |
T2364 |
T2365 |
det |
the,homology |
R1310 |
T2365 |
T2363 |
pobj |
homology,on |
R1311 |
T2366 |
T2365 |
compound |
AA,homology |
R1312 |
T2367 |
T2365 |
prep |
of,homology |
R1313 |
T2368 |
T2367 |
pobj |
proteins,of |
R1314 |
T2369 |
T2370 |
punct |
(,Fig. |
R1315 |
T2370 |
T2352 |
parataxis |
Fig.,illustrated |
R1316 |
T2371 |
T2370 |
nummod |
4,Fig. |
R1317 |
T2372 |
T2370 |
punct |
),Fig. |
R1318 |
T2373 |
T2352 |
punct |
.,illustrated |
R1319 |
T2376 |
T2377 |
nsubj |
We,found |
R1320 |
T2378 |
T2379 |
mark |
that,contain |
R1321 |
T2379 |
T2377 |
ccomp |
contain,found |
R1322 |
T2380 |
T2381 |
det |
all,members |
R1323 |
T2381 |
T2379 |
nsubj |
members,contain |
R1324 |
T2382 |
T2381 |
compound |
mouse,members |
R1325 |
T2383 |
T2381 |
compound |
Acdp,members |
R1326 |
T2384 |
T2385 |
nummod |
four,domains |
R1327 |
T2385 |
T2379 |
dobj |
domains,contain |
R1328 |
T2386 |
T2385 |
amod |
distinct,domains |
R1329 |
T2387 |
T2385 |
compound |
transmembrane,domains |
R1330 |
T2388 |
T2389 |
punct |
(,Fig. |
R1331 |
T2389 |
T2385 |
parataxis |
Fig.,domains |
R1332 |
T2390 |
T2389 |
nummod |
5,Fig. |
R1333 |
T2391 |
T2389 |
punct |
),Fig. |
R1334 |
T2392 |
T2385 |
punct |
", ",domains |
R1335 |
T2393 |
T2394 |
nummod |
two,domains |
R1336 |
T2394 |
T2385 |
conj |
domains,domains |
R1337 |
T2395 |
T2394 |
compound |
CBS,domains |
R1338 |
T2396 |
T2394 |
cc |
and,domains |
R1339 |
T2397 |
T2398 |
det |
a,domain |
R1340 |
T2398 |
T2394 |
conj |
domain,domains |
R1341 |
T2399 |
T2398 |
compound |
DUF21,domain |
R1342 |
T2400 |
T2401 |
dep |
that,found |
R1343 |
T2401 |
T2385 |
relcl |
found,domains |
R1344 |
T2402 |
T2401 |
auxpass |
are,found |
R1345 |
T2403 |
T2401 |
prep |
in,found |
R1346 |
T2404 |
T2405 |
nmod |
bacteria,CorC |
R1347 |
T2405 |
T2406 |
nmod |
CorC,proteins |
R1348 |
T2406 |
T2403 |
pobj |
proteins,in |
R1349 |
T2407 |
T2405 |
cc |
and,CorC |
R1350 |
T2408 |
T2409 |
compound |
yeast,Amip3 |
R1351 |
T2409 |
T2405 |
conj |
Amip3,CorC |
R1352 |
T2410 |
T2377 |
punct |
.,found |
R1353 |
T2412 |
T2413 |
compound |
CBS,domains |
R1354 |
T2413 |
T2414 |
nsubj |
domains,are |
R1355 |
T2415 |
T2416 |
amod |
small,modules |
R1356 |
T2416 |
T2414 |
attr |
modules,are |
R1357 |
T2417 |
T2416 |
amod |
intracellular,modules |
R1358 |
T2418 |
T2419 |
dep |
that,found |
R1359 |
T2419 |
T2416 |
relcl |
found,modules |
R1360 |
T2420 |
T2419 |
auxpass |
are,found |
R1361 |
T2421 |
T2419 |
advmod |
mostly,found |
R1362 |
T2422 |
T2419 |
prep |
in,found |
R1363 |
T2423 |
T2424 |
nummod |
2,copies |
R1364 |
T2424 |
T2422 |
pobj |
copies,in |
R1365 |
T2425 |
T2423 |
cc |
or,2 |
R1366 |
T2426 |
T2423 |
conj |
four,2 |
R1367 |
T2427 |
T2419 |
prep |
within,found |
R1368 |
T2428 |
T2429 |
det |
a,protein |
R1369 |
T2429 |
T2427 |
pobj |
protein,within |
R1370 |
T2430 |
T2414 |
punct |
.,are |
R1371 |
T2432 |
T2433 |
nsubj |
Pairs,dimerise |
R1372 |
T2434 |
T2432 |
prep |
of,Pairs |
R1373 |
T2435 |
T2436 |
compound |
CBS,domains |
R1374 |
T2436 |
T2434 |
pobj |
domains,of |
R1375 |
T2437 |
T2438 |
aux |
to,form |
R1376 |
T2438 |
T2433 |
advcl |
form,dimerise |
R1377 |
T2439 |
T2440 |
det |
a,domain |
R1378 |
T2440 |
T2438 |
dobj |
domain,form |
R1379 |
T2441 |
T2440 |
amod |
stable,domain |
R1380 |
T2442 |
T2440 |
amod |
globular,domain |
R1381 |
T2443 |
T2444 |
punct |
[,8 |
R1382 |
T2444 |
T2433 |
parataxis |
8,dimerise |
R1383 |
T2445 |
T2444 |
punct |
],8 |
R1384 |
T2446 |
T2433 |
punct |
.,dimerise |
R1385 |
T2448 |
T2449 |
nsubj |
DUF21,is |
R1386 |
T2450 |
T2451 |
punct |
(,pfam01959.9 |
R1387 |
T2451 |
T2448 |
parataxis |
pfam01959.9,DUF21 |
R1388 |
T2452 |
T2451 |
dep |
CD,pfam01959.9 |
R1389 |
T2453 |
T2451 |
punct |
: ,pfam01959.9 |
R1390 |
T2454 |
T2451 |
punct |
),pfam01959.9 |
R1391 |
T2455 |
T2456 |
det |
a,domain |
R1392 |
T2456 |
T2449 |
attr |
domain,is |
R1393 |
T2457 |
T2458 |
advmod |
newly,defined |
R1394 |
T2458 |
T2456 |
amod |
defined,domain |
R1395 |
T2459 |
T2456 |
prep |
with,domain |
R1396 |
T2460 |
T2461 |
amod |
unknown,function |
R1397 |
T2461 |
T2459 |
pobj |
function,with |
R1398 |
T2462 |
T2449 |
punct |
.,is |
R1399 |
T2464 |
T2465 |
det |
This,domain |
R1400 |
T2465 |
T2466 |
nsubj |
domain,is |
R1401 |
T2467 |
T2468 |
det |
a,region |
R1402 |
T2468 |
T2466 |
attr |
region,is |
R1403 |
T2469 |
T2468 |
amod |
transmembrane,region |
R1404 |
T2470 |
T2468 |
cc |
and,region |
R1405 |
T2471 |
T2468 |
conj |
found,region |
R1406 |
T2472 |
T2473 |
aux |
to,located |
R1407 |
T2473 |
T2471 |
xcomp |
located,found |
R1408 |
T2474 |
T2473 |
auxpass |
be,located |
R1409 |
T2475 |
T2473 |
prep |
in,located |
R1410 |
T2476 |
T2477 |
det |
the,terminus |
R1411 |
T2477 |
T2475 |
pobj |
terminus,in |
R1412 |
T2478 |
T2477 |
compound |
N,terminus |
R1413 |
T2479 |
T2477 |
punct |
-,terminus |
R1414 |
T2480 |
T2477 |
prep |
of,terminus |
R1415 |
T2481 |
T2482 |
det |
the,proteins |
R1416 |
T2482 |
T2480 |
pobj |
proteins,of |
R1417 |
T2483 |
T2482 |
amod |
adjacent,proteins |
R1418 |
T2484 |
T2483 |
prep |
to,adjacent |
R1419 |
T2485 |
T2486 |
nummod |
two,domains |
R1420 |
T2486 |
T2484 |
pobj |
domains,to |
R1421 |
T2487 |
T2486 |
amod |
intracellular,domains |
R1422 |
T2488 |
T2486 |
compound |
CBS,domains |
R1423 |
T2489 |
T2466 |
punct |
.,is |
R1424 |
T2491 |
T2492 |
det |
A,domain |
R1425 |
T2492 |
T2496 |
nsubjpass |
domain,found |
R1426 |
T2493 |
T2494 |
npadvmod |
cNMP,binding |
R1427 |
T2494 |
T2492 |
amod |
binding,domain |
R1428 |
T2495 |
T2494 |
punct |
-,binding |
R1429 |
T2497 |
T2498 |
punct |
(,domain |
R1430 |
T2498 |
T2492 |
parataxis |
domain,domain |
R1431 |
T2499 |
T2500 |
amod |
cyclic,monophosphate |
R1432 |
T2500 |
T2498 |
nmod |
monophosphate,domain |
R1433 |
T2501 |
T2500 |
nmod |
nucleotide,monophosphate |
R1434 |
T2502 |
T2500 |
punct |
-,monophosphate |
R1435 |
T2503 |
T2500 |
punct |
-,monophosphate |
R1436 |
T2504 |
T2500 |
amod |
binding,monophosphate |
R1437 |
T2505 |
T2498 |
punct |
),domain |
R1438 |
T2506 |
T2496 |
auxpass |
was,found |
R1439 |
T2507 |
T2496 |
prep |
in,found |
R1440 |
T2508 |
T2509 |
det |
all,members |
R1441 |
T2509 |
T2507 |
pobj |
members,in |
R1442 |
T2510 |
T2509 |
compound |
Acdp,members |
R1443 |
T2511 |
T2496 |
punct |
.,found |
R1444 |
T2513 |
T2514 |
prep |
In,contains |
R1445 |
T2515 |
T2513 |
pobj |
addition,In |
R1446 |
T2516 |
T2514 |
punct |
", ",contains |
R1447 |
T2517 |
T2514 |
nsubj |
Acdp1,contains |
R1448 |
T2518 |
T2519 |
det |
an,region |
R1449 |
T2519 |
T2514 |
dobj |
region,contains |
R1450 |
T2520 |
T2521 |
npadvmod |
Alanine,rich |
R1451 |
T2521 |
T2519 |
amod |
rich,region |
R1452 |
T2522 |
T2521 |
punct |
-,rich |
R1453 |
T2523 |
T2524 |
punct |
(,AAAAAAAAA |
R1454 |
T2524 |
T2519 |
parataxis |
AAAAAAAAA,region |
R1455 |
T2525 |
T2524 |
dep |
2,AAAAAAAAA |
R1456 |
T2526 |
T2527 |
punct |
–,10 |
R1457 |
T2527 |
T2525 |
prep |
10,2 |
R1458 |
T2528 |
T2524 |
punct |
: ,AAAAAAAAA |
R1459 |
T2529 |
T2524 |
punct |
),AAAAAAAAA |
R1460 |
T2530 |
T2519 |
punct |
", ",region |
R1461 |
T2531 |
T2532 |
det |
a,region |
R1462 |
T2532 |
T2519 |
conj |
region,region |
R1463 |
T2533 |
T2534 |
npadvmod |
Leucine,rich |
R1464 |
T2534 |
T2532 |
amod |
rich,region |
R1465 |
T2535 |
T2534 |
punct |
-,rich |
R1466 |
T2536 |
T2537 |
punct |
(,SGLRLSLLSLDPVELRVL |
R1467 |
T2537 |
T2532 |
parataxis |
SGLRLSLLSLDPVELRVL,region |
R1468 |
T2538 |
T2537 |
dep |
204,SGLRLSLLSLDPVELRVL |
R1469 |
T2539 |
T2540 |
punct |
–,257 |
R1470 |
T2540 |
T2538 |
prep |
257,204 |
R1471 |
T2541 |
T2537 |
punct |
: ,SGLRLSLLSLDPVELRVL |
R1472 |
T2542 |
T2537 |
compound |
LLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALF,SGLRLSLLSLDPVELRVL |
R1473 |
T2543 |
T2537 |
punct |
),SGLRLSLLSLDPVELRVL |
R1474 |
T2544 |
T2532 |
punct |
", ",region |
R1475 |
T2545 |
T2546 |
det |
a,region |
R1476 |
T2546 |
T2532 |
conj |
region,region |
R1477 |
T2547 |
T2548 |
npadvmod |
Proline,rich |
R1478 |
T2548 |
T2546 |
amod |
rich,region |
R1479 |
T2549 |
T2548 |
punct |
-,rich |
R1480 |
T2550 |
T2551 |
punct |
(,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1481 |
T2551 |
T2546 |
parataxis |
PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP,region |
R1482 |
T2552 |
T2551 |
dep |
78,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1483 |
T2553 |
T2554 |
punct |
–,130 |
R1484 |
T2554 |
T2552 |
prep |
130,78 |
R1485 |
T2555 |
T2551 |
punct |
: ,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1486 |
T2556 |
T2551 |
compound |
PGPPVPAAPVPAPSLA,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1487 |
T2557 |
T2551 |
punct |
),PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1488 |
T2558 |
T2546 |
punct |
", ",region |
R1489 |
T2559 |
T2546 |
cc |
and,region |
R1490 |
T2560 |
T2561 |
nummod |
two,sites |
R1491 |
T2561 |
T2546 |
conj |
sites,region |
R1492 |
T2562 |
T2561 |
compound |
amidation,sites |
R1493 |
T2563 |
T2564 |
punct |
(,SGRK |
R1494 |
T2564 |
T2561 |
parataxis |
SGRK,sites |
R1495 |
T2565 |
T2566 |
dep |
917,MGKK |
R1496 |
T2566 |
T2564 |
dep |
MGKK,SGRK |
R1497 |
T2567 |
T2568 |
punct |
–,920 |
R1498 |
T2568 |
T2565 |
prep |
920,917 |
R1499 |
T2569 |
T2566 |
punct |
: ,MGKK |
R1500 |
T2570 |
T2564 |
punct |
;,SGRK |
R1501 |
T2571 |
T2564 |
dep |
926,SGRK |
R1502 |
T2572 |
T2573 |
punct |
–,929 |
R1503 |
T2573 |
T2571 |
prep |
929,926 |
R1504 |
T2574 |
T2564 |
punct |
: ,SGRK |
R1505 |
T2575 |
T2564 |
punct |
),SGRK |
R1506 |
T2576 |
T2514 |
punct |
.,contains |
R1507 |
T2578 |
T2579 |
nsubj |
Acdp2,has |
R1508 |
T2580 |
T2581 |
det |
a,region |
R1509 |
T2581 |
T2579 |
dobj |
region,has |
R1510 |
T2582 |
T2583 |
npadvmod |
glycine,rich |
R1511 |
T2583 |
T2581 |
amod |
rich,region |
R1512 |
T2584 |
T2583 |
punct |
-,rich |
R1513 |
T2585 |
T2586 |
punct |
(,GAGGSGSASGTVGGKGGAGVAG |
R1514 |
T2586 |
T2581 |
parataxis |
GAGGSGSASGTVGGKGGAGVAG,region |
R1515 |
T2587 |
T2586 |
dep |
201,GAGGSGSASGTVGGKGGAGVAG |
R1516 |
T2588 |
T2589 |
punct |
–,222 |
R1517 |
T2589 |
T2587 |
prep |
222,201 |
R1518 |
T2590 |
T2586 |
punct |
: ,GAGGSGSASGTVGGKGGAGVAG |
R1519 |
T2591 |
T2586 |
punct |
),GAGGSGSASGTVGGKGGAGVAG |
R1520 |
T2592 |
T2579 |
punct |
.,has |
R1521 |
T2594 |
T2595 |
nsubj |
Acdp3,possesses |
R1522 |
T2596 |
T2597 |
det |
a,region |
R1523 |
T2597 |
T2595 |
dobj |
region,possesses |
R1524 |
T2598 |
T2597 |
amod |
large,region |
R1525 |
T2599 |
T2600 |
npadvmod |
alanine,rich |
R1526 |
T2600 |
T2597 |
amod |
rich,region |
R1527 |
T2601 |
T2600 |
punct |
-,rich |
R1528 |
T2602 |
T2603 |
punct |
(,2 |
R1529 |
T2603 |
T2597 |
parataxis |
2,region |
R1530 |
T2604 |
T2605 |
punct |
–,261 |
R1531 |
T2605 |
T2603 |
prep |
261,2 |
R1532 |
T2606 |
T2603 |
punct |
),2 |
R1533 |
T2607 |
T2597 |
cc |
and,region |
R1534 |
T2608 |
T2609 |
det |
a,region |
R1535 |
T2609 |
T2597 |
conj |
region,region |
R1536 |
T2610 |
T2609 |
amod |
large,region |
R1537 |
T2611 |
T2612 |
npadvmod |
leucine,rich |
R1538 |
T2612 |
T2609 |
amod |
rich,region |
R1539 |
T2613 |
T2612 |
punct |
-,rich |
R1540 |
T2614 |
T2615 |
punct |
(,201 |
R1541 |
T2615 |
T2609 |
parataxis |
201,region |
R1542 |
T2616 |
T2617 |
punct |
–,299 |
R1543 |
T2617 |
T2615 |
prep |
299,201 |
R1544 |
T2618 |
T2615 |
punct |
),201 |
R1545 |
T2619 |
T2595 |
punct |
.,possesses |
R1546 |
T2621 |
T2622 |
nsubj |
Acdp4,contains |
R1547 |
T2623 |
T2624 |
det |
a,pattern |
R1548 |
T2624 |
T2622 |
dobj |
pattern,contains |
R1549 |
T2625 |
T2624 |
compound |
leucine,pattern |
R1550 |
T2626 |
T2624 |
compound |
zipper,pattern |
R1551 |
T2627 |
T2628 |
punct |
(,LVMVLLVLSGIFSGLNLGLMAL |
R1552 |
T2628 |
T2624 |
parataxis |
LVMVLLVLSGIFSGLNLGLMAL,pattern |
R1553 |
T2629 |
T2628 |
dep |
185,LVMVLLVLSGIFSGLNLGLMAL |
R1554 |
T2630 |
T2631 |
punct |
–,206 |
R1555 |
T2631 |
T2629 |
prep |
206,185 |
R1556 |
T2632 |
T2628 |
punct |
: ,LVMVLLVLSGIFSGLNLGLMAL |
R1557 |
T2633 |
T2628 |
punct |
),LVMVLLVLSGIFSGLNLGLMAL |
R1558 |
T2634 |
T2624 |
cc |
and,pattern |
R1559 |
T2635 |
T2636 |
det |
an,site |
R1560 |
T2636 |
T2624 |
conj |
site,pattern |
R1561 |
T2637 |
T2636 |
compound |
amidation,site |
R1562 |
T2638 |
T2639 |
punct |
(,GGRR |
R1563 |
T2639 |
T2636 |
parataxis |
GGRR,site |
R1564 |
T2640 |
T2639 |
dep |
7,GGRR |
R1565 |
T2641 |
T2642 |
punct |
–,10 |
R1566 |
T2642 |
T2640 |
prep |
10,7 |
R1567 |
T2643 |
T2639 |
punct |
: ,GGRR |
R1568 |
T2644 |
T2639 |
punct |
),GGRR |
R1569 |
T2645 |
T2622 |
punct |
.,contains |
R1572 |
T2862 |
T2863 |
compound |
Antibody,production |
R1573 |
T2864 |
T2863 |
punct |
", ",production |
R1574 |
T2865 |
T2866 |
compound |
Western,results |
R1575 |
T2866 |
T2863 |
conj |
results,production |
R1576 |
T2867 |
T2866 |
cc |
and,results |
R1577 |
T2868 |
T2869 |
amod |
subcellular,localization |
R1578 |
T2869 |
T2866 |
conj |
localization,results |
R1579 |
T2871 |
T2872 |
nsubjpass |
Peptides,synthesized |
R1580 |
T2873 |
T2871 |
prep |
from,Peptides |
R1581 |
T2874 |
T2875 |
nmod |
Acdp1,terminuses |
R1582 |
T2875 |
T2873 |
pobj |
terminuses,from |
R1583 |
T2876 |
T2875 |
nmod |
N,terminuses |
R1584 |
T2877 |
T2876 |
punct |
-,N |
R1585 |
T2878 |
T2876 |
punct |
(,N |
R1586 |
T2879 |
T2876 |
appos |
TSFLLRVYFQPGPPATAAPVPSPT,N |
R1587 |
T2880 |
T2876 |
punct |
),N |
R1588 |
T2881 |
T2876 |
cc |
and,N |
R1589 |
T2882 |
T2876 |
conj |
C,N |
R1590 |
T2883 |
T2882 |
punct |
-,C |
R1591 |
T2884 |
T2882 |
punct |
(,C |
R1592 |
T2885 |
T2882 |
appos |
TQQLTLSPAAVPTR,C |
R1593 |
T2886 |
T2875 |
punct |
),terminuses |
R1594 |
T2887 |
T2871 |
punct |
", ",Peptides |
R1595 |
T2888 |
T2889 |
amod |
conserved,peptide |
R1596 |
T2889 |
T2871 |
appos |
peptide,Peptides |
R1597 |
T2890 |
T2889 |
prep |
from,peptide |
R1598 |
T2891 |
T2892 |
compound |
ACD,domain |
R1599 |
T2892 |
T2890 |
pobj |
domain,from |
R1600 |
T2893 |
T2892 |
prep |
of,domain |
R1601 |
T2894 |
T2893 |
pobj |
Acdp1,of |
R1602 |
T2895 |
T2894 |
punct |
(,Acdp1 |
R1603 |
T2896 |
T2894 |
appos |
HNIVDILFVKDLAFVDPDDCTPLLTVTRF,Acdp1 |
R1604 |
T2897 |
T2872 |
punct |
),synthesized |
R1605 |
T2898 |
T2872 |
auxpass |
were,synthesized |
R1606 |
T2899 |
T2872 |
advmod |
commercially,synthesized |
R1607 |
T2900 |
T2901 |
punct |
(,Genosys |
R1608 |
T2901 |
T2872 |
parataxis |
Genosys,synthesized |
R1609 |
T2902 |
T2901 |
compound |
Sigma,Genosys |
R1610 |
T2903 |
T2901 |
punct |
),Genosys |
R1611 |
T2904 |
T2872 |
punct |
.,synthesized |
R1612 |
T2906 |
T2907 |
det |
These,sites |
R1613 |
T2907 |
T2909 |
nsubjpass |
sites,predicted |
R1614 |
T2908 |
T2907 |
amod |
antigenic,sites |
R1615 |
T2910 |
T2909 |
auxpass |
were,predicted |
R1616 |
T2911 |
T2909 |
prep |
by,predicted |
R1617 |
T2912 |
T2911 |
pobj |
software,by |
R1618 |
T2913 |
T2912 |
prep |
from,software |
R1619 |
T2914 |
T2915 |
compound |
Sigma,Genosys |
R1620 |
T2915 |
T2913 |
pobj |
Genosys,from |
R1621 |
T2916 |
T2909 |
cc |
and,predicted |
R1622 |
T2917 |
T2918 |
amod |
polyclonal,antibodies |
R1623 |
T2918 |
T2919 |
nsubjpass |
antibodies,produced |
R1624 |
T2919 |
T2909 |
conj |
produced,predicted |
R1625 |
T2920 |
T2918 |
prep |
for,antibodies |
R1626 |
T2921 |
T2922 |
det |
each,peptide |
R1627 |
T2922 |
T2920 |
pobj |
peptide,for |
R1628 |
T2923 |
T2919 |
auxpass |
were,produced |
R1629 |
T2924 |
T2919 |
prep |
by,produced |
R1630 |
T2925 |
T2924 |
pcomp |
immunizing,by |
R1631 |
T2926 |
T2925 |
dobj |
rabbits,immunizing |
R1632 |
T2927 |
T2919 |
punct |
.,produced |
R1633 |
T2929 |
T2930 |
aux |
To,test |
R1634 |
T2930 |
T2931 |
advcl |
test,conducted |
R1635 |
T2932 |
T2933 |
det |
the,specificity |
R1636 |
T2933 |
T2930 |
dobj |
specificity,test |
R1637 |
T2934 |
T2933 |
prep |
of,specificity |
R1638 |
T2935 |
T2936 |
det |
the,antibodies |
R1639 |
T2936 |
T2934 |
pobj |
antibodies,of |
R1640 |
T2937 |
T2931 |
punct |
", ",conducted |
R1641 |
T2938 |
T2931 |
nsubj |
we,conducted |
R1642 |
T2939 |
T2940 |
compound |
Western,blot |
R1643 |
T2940 |
T2942 |
compound |
blot,analysis |
R1644 |
T2941 |
T2940 |
punct |
-,blot |
R1645 |
T2942 |
T2931 |
dobj |
analysis,conducted |
R1646 |
T2943 |
T2942 |
prep |
of,analysis |
R1647 |
T2944 |
T2945 |
compound |
mouse,brain |
R1648 |
T2945 |
T2946 |
compound |
brain,tissue |
R1649 |
T2946 |
T2947 |
compound |
tissue,extracts |
R1650 |
T2947 |
T2943 |
pobj |
extracts,of |
R1651 |
T2948 |
T2931 |
punct |
.,conducted |
R1652 |
T2950 |
T2951 |
mark |
As,shown |
R1653 |
T2951 |
T2952 |
advcl |
shown,detected |
R1654 |
T2953 |
T2951 |
prep |
in,shown |
R1655 |
T2954 |
T2953 |
pobj |
Fig.,in |
R1656 |
T2955 |
T2954 |
nummod |
6A,Fig. |
R1657 |
T2956 |
T2952 |
punct |
", ",detected |
R1658 |
T2957 |
T2958 |
det |
the,antibody |
R1659 |
T2958 |
T2952 |
nsubj |
antibody,detected |
R1660 |
T2959 |
T2958 |
acl |
produced,antibody |
R1661 |
T2960 |
T2959 |
prep |
by,produced |
R1662 |
T2961 |
T2962 |
nmod |
C,peptide |
R1663 |
T2962 |
T2960 |
pobj |
peptide,by |
R1664 |
T2963 |
T2961 |
punct |
-,C |
R1665 |
T2964 |
T2961 |
amod |
terminal,C |
R1666 |
T2965 |
T2952 |
advmod |
specifically,detected |
R1667 |
T2966 |
T2952 |
dobj |
Acdp1,detected |
R1668 |
T2967 |
T2968 |
punct |
(,lane |
R1669 |
T2968 |
T2952 |
parataxis |
lane,detected |
R1670 |
T2969 |
T2968 |
nummod |
3,lane |
R1671 |
T2970 |
T2968 |
punct |
),lane |
R1672 |
T2971 |
T2952 |
punct |
.,detected |
R1673 |
T2973 |
T2974 |
det |
The,antibody |
R1674 |
T2974 |
T2975 |
nsubj |
antibody,recognized |
R1675 |
T2976 |
T2974 |
acl |
generated,antibody |
R1676 |
T2977 |
T2976 |
agent |
by,generated |
R1677 |
T2978 |
T2979 |
nmod |
N,peptide |
R1678 |
T2979 |
T2977 |
pobj |
peptide,by |
R1679 |
T2980 |
T2978 |
punct |
-,N |
R1680 |
T2981 |
T2978 |
amod |
terminal,N |
R1681 |
T2982 |
T2975 |
dobj |
Acdp4,recognized |
R1682 |
T2983 |
T2975 |
prep |
in,recognized |
R1683 |
T2984 |
T2983 |
pobj |
addition,in |
R1684 |
T2985 |
T2984 |
prep |
to,addition |
R1685 |
T2986 |
T2985 |
pobj |
Acdp1,to |
R1686 |
T2987 |
T2975 |
punct |
", ",recognized |
R1687 |
T2988 |
T2989 |
mark |
although,was |
R1688 |
T2989 |
T2975 |
advcl |
was,recognized |
R1689 |
T2990 |
T2991 |
det |
the,reactivity |
R1690 |
T2991 |
T2989 |
nsubj |
reactivity,was |
R1691 |
T2992 |
T2991 |
prep |
to,reactivity |
R1692 |
T2993 |
T2992 |
pobj |
latter,to |
R1693 |
T2994 |
T2995 |
advmod |
significantly,higher |
R1694 |
T2995 |
T2989 |
acomp |
higher,was |
R1695 |
T2996 |
T2997 |
punct |
(,lane |
R1696 |
T2997 |
T2975 |
parataxis |
lane,recognized |
R1697 |
T2998 |
T2997 |
dep |
Fig.,lane |
R1698 |
T2999 |
T2998 |
nummod |
6A,Fig. |
R1699 |
T3000 |
T2997 |
punct |
", ",lane |
R1700 |
T3001 |
T2997 |
nummod |
2,lane |
R1701 |
T3002 |
T2997 |
punct |
),lane |
R1702 |
T3003 |
T2975 |
punct |
.,recognized |
R1703 |
T3005 |
T3006 |
mark |
As,expected |
R1704 |
T3006 |
T3007 |
advcl |
expected,detected |
R1705 |
T3008 |
T3007 |
punct |
", ",detected |
R1706 |
T3009 |
T3010 |
det |
the,antibody |
R1707 |
T3010 |
T3007 |
nsubj |
antibody,detected |
R1708 |
T3011 |
T3010 |
acl |
produced,antibody |
R1709 |
T3012 |
T3011 |
agent |
by,produced |
R1710 |
T3013 |
T3014 |
det |
the,peptide |
R1711 |
T3014 |
T3012 |
pobj |
peptide,by |
R1712 |
T3015 |
T3014 |
amod |
conserved,peptide |
R1713 |
T3016 |
T3014 |
compound |
sequence,peptide |
R1714 |
T3017 |
T3018 |
det |
all,proteins |
R1715 |
T3018 |
T3007 |
dobj |
proteins,detected |
R1716 |
T3019 |
T3018 |
compound |
Acdp,proteins |
R1717 |
T3020 |
T3021 |
punct |
(,lane |
R1718 |
T3021 |
T3007 |
parataxis |
lane,detected |
R1719 |
T3022 |
T3021 |
dep |
Fig.,lane |
R1720 |
T3023 |
T3022 |
nummod |
6A,Fig. |
R1721 |
T3024 |
T3021 |
punct |
", ",lane |
R1722 |
T3025 |
T3021 |
nummod |
1,lane |
R1723 |
T3026 |
T3021 |
punct |
),lane |
R1724 |
T3027 |
T3007 |
punct |
.,detected |
R1725 |
T3029 |
T3030 |
aux |
To,determine |
R1726 |
T3030 |
T3032 |
advcl |
determine,analyzed |
R1727 |
T3031 |
T3030 |
advmod |
further,determine |
R1728 |
T3033 |
T3034 |
det |
the,specificity |
R1729 |
T3034 |
T3030 |
dobj |
specificity,determine |
R1730 |
T3035 |
T3034 |
prep |
of,specificity |
R1731 |
T3036 |
T3037 |
det |
the,antibody |
R1732 |
T3037 |
T3035 |
pobj |
antibody,of |
R1733 |
T3038 |
T3034 |
prep |
against,specificity |
R1734 |
T3039 |
T3040 |
det |
the,terminus |
R1735 |
T3040 |
T3038 |
pobj |
terminus,against |
R1736 |
T3041 |
T3040 |
compound |
Acdp1,terminus |
R1737 |
T3042 |
T3040 |
compound |
C,terminus |
R1738 |
T3043 |
T3040 |
punct |
-,terminus |
R1739 |
T3044 |
T3032 |
punct |
", ",analyzed |
R1740 |
T3045 |
T3032 |
nsubj |
we,analyzed |
R1741 |
T3046 |
T3032 |
dobj |
extracts,analyzed |
R1742 |
T3047 |
T3046 |
prep |
of,extracts |
R1743 |
T3048 |
T3049 |
nmod |
HEK293,cells |
R1744 |
T3049 |
T3047 |
pobj |
cells,of |
R1745 |
T3050 |
T3048 |
punct |
", ",HEK293 |
R1746 |
T3051 |
T3048 |
conj |
3T3,HEK293 |
R1747 |
T3052 |
T3051 |
cc |
and,3T3 |
R1748 |
T3053 |
T3051 |
conj |
PC12,3T3 |
R1749 |
T3054 |
T3032 |
punct |
.,analyzed |
R1750 |
T3056 |
T3057 |
det |
The,results |
R1751 |
T3057 |
T3058 |
nsubjpass |
results,shown |
R1752 |
T3059 |
T3058 |
auxpass |
are,shown |
R1753 |
T3060 |
T3058 |
prep |
in,shown |
R1754 |
T3061 |
T3060 |
pobj |
Fig.,in |
R1755 |
T3062 |
T3061 |
nummod |
6B,Fig. |
R1756 |
T3063 |
T3058 |
punct |
.,shown |
R1757 |
T3065 |
T3066 |
advmod |
Apparently,detected |
R1758 |
T3067 |
T3066 |
punct |
", ",detected |
R1759 |
T3068 |
T3069 |
det |
this,antibody |
R1760 |
T3069 |
T3066 |
nsubj |
antibody,detected |
R1761 |
T3070 |
T3071 |
det |
a,band |
R1762 |
T3071 |
T3066 |
dobj |
band,detected |
R1763 |
T3072 |
T3071 |
amod |
specific,band |
R1764 |
T3073 |
T3071 |
prep |
of,band |
R1765 |
T3074 |
T3073 |
pobj |
Acdp1,of |
R1766 |
T3075 |
T3066 |
prep |
in,detected |
R1767 |
T3076 |
T3077 |
det |
all,lysates |
R1768 |
T3077 |
T3075 |
pobj |
lysates,in |
R1769 |
T3078 |
T3077 |
compound |
cell,lysates |
R1770 |
T3079 |
T3066 |
punct |
.,detected |
R1771 |
T3081 |
T3082 |
prep |
Of,are |
R1772 |
T3083 |
T3081 |
pobj |
note,Of |
R1773 |
T3084 |
T3082 |
punct |
", ",are |
R1774 |
T3085 |
T3082 |
dep |
shown,are |
R1775 |
T3086 |
T3085 |
prep |
in,shown |
R1776 |
T3087 |
T3086 |
pobj |
Fig.,in |
R1777 |
T3088 |
T3087 |
nummod |
6B,Fig. |
R1778 |
T3089 |
T3082 |
nsubj |
signals,are |
R1779 |
T3090 |
T3089 |
prep |
of,signals |
R1780 |
T3091 |
T3092 |
nummod |
10,μg |
R1781 |
T3092 |
T3093 |
compound |
μg,extracts |
R1782 |
T3093 |
T3090 |
pobj |
extracts,of |
R1783 |
T3094 |
T3093 |
prep |
of,extracts |
R1784 |
T3095 |
T3096 |
compound |
HEK293,lysates |
R1785 |
T3096 |
T3094 |
pobj |
lysates,of |
R1786 |
T3097 |
T3096 |
compound |
cell,lysates |
R1787 |
T3098 |
T3093 |
punct |
", ",extracts |
R1788 |
T3099 |
T3100 |
nummod |
100,μg |
R1789 |
T3100 |
T3101 |
compound |
μg,extracts |
R1790 |
T3101 |
T3093 |
appos |
extracts,extracts |
R1791 |
T3102 |
T3101 |
prep |
of,extracts |
R1792 |
T3103 |
T3104 |
nmod |
3T3,lysates |
R1793 |
T3104 |
T3102 |
pobj |
lysates,of |
R1794 |
T3105 |
T3103 |
cc |
and,3T3 |
R1795 |
T3106 |
T3103 |
conj |
PC12,3T3 |
R1796 |
T3107 |
T3104 |
compound |
cell,lysates |
R1797 |
T3108 |
T3082 |
punct |
.,are |
R1798 |
T3110 |
T3111 |
advmod |
Thus,vary |
R1799 |
T3112 |
T3111 |
punct |
", ",vary |
R1800 |
T3113 |
T3114 |
det |
the,levels |
R1801 |
T3114 |
T3111 |
nsubj |
levels,vary |
R1802 |
T3115 |
T3114 |
compound |
expression,levels |
R1803 |
T3116 |
T3114 |
prep |
of,levels |
R1804 |
T3117 |
T3116 |
pobj |
Acdp1,of |
R1805 |
T3118 |
T3114 |
prep |
in,levels |
R1806 |
T3119 |
T3120 |
det |
these,types |
R1807 |
T3120 |
T3118 |
pobj |
types,in |
R1808 |
T3121 |
T3120 |
compound |
cell,types |
R1809 |
T3122 |
T3123 |
det |
a,lot |
R1810 |
T3123 |
T3111 |
dobj |
lot,vary |
R1811 |
T3124 |
T3111 |
punct |
", ",vary |
R1812 |
T3125 |
T3111 |
prep |
with,vary |
R1813 |
T3126 |
T3127 |
det |
the,expression |
R1814 |
T3127 |
T3125 |
pobj |
expression,with |
R1815 |
T3128 |
T3127 |
amod |
highest,expression |
R1816 |
T3129 |
T3127 |
prep |
in,expression |
R1817 |
T3130 |
T3131 |
compound |
HEK293,cells |
R1818 |
T3131 |
T3129 |
pobj |
cells,in |
R1819 |
T3132 |
T3111 |
punct |
.,vary |
R1820 |
T3134 |
T3135 |
advmod |
Nevertheless,support |
R1821 |
T3136 |
T3135 |
punct |
", ",support |
R1822 |
T3137 |
T3138 |
det |
these,results |
R1823 |
T3138 |
T3135 |
nsubj |
results,support |
R1824 |
T3139 |
T3138 |
compound |
immunoblot,results |
R1825 |
T3140 |
T3141 |
poss |
our,analysis |
R1826 |
T3141 |
T3135 |
dobj |
analysis,support |
R1827 |
T3142 |
T3141 |
prep |
of,analysis |
R1828 |
T3143 |
T3144 |
compound |
brain,extracts |
R1829 |
T3144 |
T3142 |
pobj |
extracts,of |
R1830 |
T3145 |
T3144 |
compound |
tissue,extracts |
R1831 |
T3146 |
T3147 |
mark |
that,recognizes |
R1832 |
T3147 |
T3141 |
acl |
recognizes,analysis |
R1833 |
T3148 |
T3149 |
det |
the,antibody |
R1834 |
T3149 |
T3147 |
nsubj |
antibody,recognizes |
R1835 |
T3150 |
T3149 |
prep |
against,antibody |
R1836 |
T3151 |
T3152 |
compound |
Acdp1,terminus |
R1837 |
T3152 |
T3150 |
pobj |
terminus,against |
R1838 |
T3153 |
T3152 |
compound |
C,terminus |
R1839 |
T3154 |
T3152 |
punct |
-,terminus |
R1840 |
T3155 |
T3147 |
advmod |
specifically,recognizes |
R1841 |
T3156 |
T3147 |
dobj |
Acdp,recognizes |
R1842 |
T3157 |
T3156 |
punct |
-,Acdp |
R1843 |
T3158 |
T3156 |
nummod |
1,Acdp |
R1844 |
T3159 |
T3135 |
punct |
.,support |
R1845 |
T3161 |
T3162 |
det |
The,specificity |
R1846 |
T3162 |
T3163 |
nsubj |
specificity,suggests |
R1847 |
T3164 |
T3162 |
prep |
of,specificity |
R1848 |
T3165 |
T3166 |
det |
the,antibody |
R1849 |
T3166 |
T3164 |
pobj |
antibody,of |
R1850 |
T3167 |
T3166 |
compound |
Acdp1,antibody |
R1851 |
T3168 |
T3169 |
compound |
C,terminus |
R1852 |
T3169 |
T3166 |
compound |
terminus,antibody |
R1853 |
T3170 |
T3169 |
punct |
-,terminus |
R1854 |
T3171 |
T3172 |
det |
the,possibility |
R1855 |
T3172 |
T3163 |
dobj |
possibility,suggests |
R1856 |
T3173 |
T3172 |
prep |
of,possibility |
R1857 |
T3174 |
T3173 |
pcomp |
using,of |
R1858 |
T3175 |
T3174 |
dobj |
it,using |
R1859 |
T3176 |
T3177 |
aux |
to,localize |
R1860 |
T3177 |
T3174 |
advcl |
localize,using |
R1861 |
T3178 |
T3177 |
dobj |
Acdp,localize |
R1862 |
T3179 |
T3178 |
punct |
-,Acdp |
R1863 |
T3180 |
T3178 |
nummod |
1,Acdp |
R1864 |
T3181 |
T3177 |
prep |
within,localize |
R1865 |
T3182 |
T3181 |
pobj |
cells,within |
R1866 |
T3183 |
T3163 |
punct |
.,suggests |
R1867 |
T3185 |
T3186 |
mark |
Since,revealed |
R1868 |
T3186 |
T3189 |
advcl |
revealed,examined |
R1869 |
T3187 |
T3188 |
compound |
Northern,blot |
R1870 |
T3188 |
T3186 |
nsubj |
blot,revealed |
R1871 |
T3190 |
T3191 |
advmod |
almost,exclusive |
R1872 |
T3191 |
T3192 |
amod |
exclusive,expression |
R1873 |
T3192 |
T3186 |
dobj |
expression,revealed |
R1874 |
T3193 |
T3192 |
prep |
of,expression |
R1875 |
T3194 |
T3193 |
pobj |
Acdp1,of |
R1876 |
T3195 |
T3186 |
prep |
in,revealed |
R1877 |
T3196 |
T3197 |
det |
the,brain |
R1878 |
T3197 |
T3195 |
pobj |
brain,in |
R1879 |
T3198 |
T3189 |
punct |
", ",examined |
R1880 |
T3199 |
T3189 |
nsubj |
we,examined |
R1881 |
T3200 |
T3201 |
poss |
its,localization |
R1882 |
T3201 |
T3189 |
dobj |
localization,examined |
R1883 |
T3202 |
T3201 |
amod |
subcellular,localization |
R1884 |
T3203 |
T3189 |
prep |
in,examined |
R1885 |
T3204 |
T3205 |
compound |
hippocampus,neurons |
R1886 |
T3205 |
T3203 |
pobj |
neurons,in |
R1887 |
T3206 |
T3205 |
acl |
isolated,neurons |
R1888 |
T3207 |
T3206 |
prep |
from,isolated |
R1889 |
T3208 |
T3209 |
compound |
mouse,embryos |
R1890 |
T3209 |
T3207 |
pobj |
embryos,from |
R1891 |
T3210 |
T3189 |
punct |
.,examined |
R1892 |
T3212 |
T3213 |
det |
The,neurons |
R1893 |
T3213 |
T3214 |
nsubjpass |
neurons,cultured |
R1894 |
T3215 |
T3214 |
auxpass |
were,cultured |
R1895 |
T3216 |
T3214 |
prep |
on,cultured |
R1896 |
T3217 |
T3218 |
compound |
glass,coverslips |
R1897 |
T3218 |
T3216 |
pobj |
coverslips,on |
R1898 |
T3219 |
T3218 |
acl |
coated,coverslips |
R1899 |
T3220 |
T3219 |
prep |
with,coated |
R1900 |
T3221 |
T3222 |
det |
a,monolayer |
R1901 |
T3222 |
T3220 |
pobj |
monolayer,with |
R1902 |
T3223 |
T3222 |
amod |
confluent,monolayer |
R1903 |
T3224 |
T3222 |
prep |
of,monolayer |
R1904 |
T3225 |
T3226 |
nmod |
mouse,astrocytes |
R1905 |
T3226 |
T3224 |
pobj |
astrocytes,of |
R1906 |
T3227 |
T3226 |
amod |
cortical,astrocytes |
R1907 |
T3228 |
T3214 |
prep |
in,cultured |
R1908 |
T3229 |
T3228 |
pobj |
dishes,in |
R1909 |
T3230 |
T3214 |
punct |
.,cultured |
R1910 |
T3232 |
T3233 |
nsubj |
Immunostaining,using |
R1911 |
T3234 |
T3233 |
aux |
was,using |
R1912 |
T3235 |
T3236 |
det |
the,antibody |
R1913 |
T3236 |
T3233 |
dobj |
antibody,using |
R1914 |
T3237 |
T3236 |
nmod |
Acdp1,antibody |
R1915 |
T3238 |
T3239 |
compound |
C,terminus |
R1916 |
T3239 |
T3241 |
npadvmod |
terminus,specific |
R1917 |
T3240 |
T3239 |
punct |
-,terminus |
R1918 |
T3241 |
T3236 |
amod |
specific,antibody |
R1919 |
T3242 |
T3233 |
punct |
.,using |
R1920 |
T3244 |
T3245 |
amod |
Confocal,imaging |
R1921 |
T3245 |
T3246 |
nsubj |
imaging,revealed |
R1922 |
T3247 |
T3248 |
mark |
that,localized |
R1923 |
T3248 |
T3246 |
ccomp |
localized,revealed |
R1924 |
T3249 |
T3248 |
nsubjpass |
Acdp1,localized |
R1925 |
T3250 |
T3248 |
auxpass |
is,localized |
R1926 |
T3251 |
T3248 |
advmod |
predominantly,localized |
R1927 |
T3252 |
T3248 |
prep |
on,localized |
R1928 |
T3253 |
T3254 |
det |
the,membrane |
R1929 |
T3254 |
T3252 |
pobj |
membrane,on |
R1930 |
T3255 |
T3254 |
compound |
plasma,membrane |
R1931 |
T3256 |
T3246 |
punct |
.,revealed |
R1932 |
T3258 |
T3259 |
det |
A,series |
R1933 |
T3259 |
T3260 |
nsubj |
series,showed |
R1934 |
T3261 |
T3259 |
prep |
of,series |
R1935 |
T3262 |
T3261 |
pobj |
sections,of |
R1936 |
T3263 |
T3262 |
prep |
of,sections |
R1937 |
T3264 |
T3265 |
det |
a,cell |
R1938 |
T3265 |
T3263 |
pobj |
cell,of |
R1939 |
T3266 |
T3259 |
prep |
at,series |
R1940 |
T3267 |
T3268 |
det |
the,thickness |
R1941 |
T3268 |
T3266 |
pobj |
thickness,at |
R1942 |
T3269 |
T3268 |
prep |
of,thickness |
R1943 |
T3270 |
T3271 |
nummod |
0.5,micrometer |
R1944 |
T3271 |
T3269 |
pobj |
micrometer,of |
R1945 |
T3272 |
T3260 |
advmod |
clearly,showed |
R1946 |
T3273 |
T3274 |
compound |
membrane,location |
R1947 |
T3274 |
T3260 |
dobj |
location,showed |
R1948 |
T3275 |
T3274 |
prep |
of,location |
R1949 |
T3276 |
T3277 |
compound |
Acdp1,immunoreactivity |
R1950 |
T3277 |
T3275 |
pobj |
immunoreactivity,of |
R1951 |
T3278 |
T3277 |
punct |
-,immunoreactivity |
R1952 |
T3279 |
T3280 |
punct |
(,Fig. |
R1953 |
T3280 |
T3277 |
parataxis |
Fig.,immunoreactivity |
R1954 |
T3281 |
T3280 |
nummod |
7,Fig. |
R1955 |
T3282 |
T3280 |
punct |
),Fig. |
R1956 |
T3283 |
T3260 |
punct |
", ",showed |
R1957 |
T3284 |
T3285 |
dep |
which,is |
R1958 |
T3285 |
T3260 |
advcl |
is,showed |
R1959 |
T3286 |
T3285 |
acomp |
consistent,is |
R1960 |
T3287 |
T3286 |
prep |
with,consistent |
R1961 |
T3288 |
T3289 |
det |
the,observation |
R1962 |
T3289 |
T3287 |
pobj |
observation,with |
R1963 |
T3290 |
T3289 |
prep |
of,observation |
R1964 |
T3291 |
T3292 |
compound |
transmembrane,domains |
R1965 |
T3292 |
T3290 |
pobj |
domains,of |
R1966 |
T3293 |
T3289 |
prep |
within,observation |
R1967 |
T3294 |
T3295 |
det |
the,proteins |
R1968 |
T3295 |
T3293 |
pobj |
proteins,within |
R1969 |
T3296 |
T3295 |
compound |
Acdp,proteins |
R1970 |
T3297 |
T3260 |
punct |
.,showed |
R1973 |
T3529 |
T3530 |
mark |
Although,elucidated |
R1974 |
T3530 |
T3542 |
advcl |
elucidated,suggest |
R1975 |
T3531 |
T3532 |
det |
the,functions |
R1976 |
T3532 |
T3530 |
nsubjpass |
functions,elucidated |
R1977 |
T3533 |
T3532 |
amod |
exact,functions |
R1978 |
T3534 |
T3532 |
prep |
of,functions |
R1979 |
T3535 |
T3536 |
det |
the,family |
R1980 |
T3536 |
T3534 |
pobj |
family,of |
R1981 |
T3537 |
T3536 |
compound |
ACDP,family |
R1982 |
T3538 |
T3536 |
compound |
gene,family |
R1983 |
T3539 |
T3530 |
auxpass |
are,elucidated |
R1984 |
T3540 |
T3530 |
neg |
not,elucidated |
R1985 |
T3541 |
T3530 |
advmod |
yet,elucidated |
R1986 |
T3543 |
T3542 |
punct |
", ",suggest |
R1987 |
T3544 |
T3545 |
amod |
several,lines |
R1988 |
T3545 |
T3542 |
nsubj |
lines,suggest |
R1989 |
T3546 |
T3545 |
prep |
of,lines |
R1990 |
T3547 |
T3546 |
pobj |
evidence,of |
R1991 |
T3548 |
T3549 |
mark |
that,play |
R1992 |
T3549 |
T3542 |
ccomp |
play,suggest |
R1993 |
T3550 |
T3551 |
compound |
ACDP,genes |
R1994 |
T3551 |
T3549 |
nsubj |
genes,play |
R1995 |
T3552 |
T3549 |
aux |
may,play |
R1996 |
T3553 |
T3554 |
det |
an,role |
R1997 |
T3554 |
T3549 |
dobj |
role,play |
R1998 |
T3555 |
T3554 |
amod |
important,role |
R1999 |
T3556 |
T3549 |
prep |
in,play |
R2000 |
T3557 |
T3558 |
amod |
biological,processes |
R2001 |
T3558 |
T3556 |
pobj |
processes,in |
R2002 |
T3559 |
T3542 |
punct |
.,suggest |
R2003 |
T3561 |
T3562 |
advmod |
First,conserved |
R2004 |
T3562 |
T3568 |
ccomp |
conserved,expressed |
R2005 |
T3563 |
T3562 |
punct |
", ",conserved |
R2006 |
T3564 |
T3565 |
det |
these,genes |
R2007 |
T3565 |
T3562 |
nsubjpass |
genes,conserved |
R2008 |
T3566 |
T3562 |
auxpass |
are,conserved |
R2009 |
T3567 |
T3562 |
advmod |
evolutionarily,conserved |
R2010 |
T3569 |
T3562 |
prep |
in,conserved |
R2011 |
T3570 |
T3571 |
amod |
many,species |
R2012 |
T3571 |
T3569 |
pobj |
species,in |
R2013 |
T3572 |
T3573 |
advmod |
phylogenetically,divergent |
R2014 |
T3573 |
T3571 |
amod |
divergent,species |
R2015 |
T3574 |
T3568 |
punct |
;,expressed |
R2016 |
T3575 |
T3576 |
advmod |
Second,are |
R2017 |
T3576 |
T3568 |
ccomp |
are,expressed |
R2018 |
T3577 |
T3576 |
punct |
", ",are |
R2019 |
T3578 |
T3579 |
amod |
multiple,genes |
R2020 |
T3579 |
T3576 |
nsubj |
genes,are |
R2021 |
T3580 |
T3576 |
acomp |
present,are |
R2022 |
T3581 |
T3576 |
prep |
in,are |
R2023 |
T3582 |
T3583 |
det |
a,species |
R2024 |
T3583 |
T3581 |
pobj |
species,in |
R2025 |
T3584 |
T3568 |
punct |
;,expressed |
R2026 |
T3585 |
T3568 |
advmod |
Third,expressed |
R2027 |
T3586 |
T3568 |
punct |
", ",expressed |
R2028 |
T3587 |
T3588 |
det |
these,genes |
R2029 |
T3588 |
T3568 |
nsubjpass |
genes,expressed |
R2030 |
T3589 |
T3568 |
auxpass |
are,expressed |
R2031 |
T3590 |
T3568 |
advmod |
ubiquitously,expressed |
R2032 |
T3591 |
T3568 |
prep |
throughout,expressed |
R2033 |
T3592 |
T3593 |
nmod |
development,tissues |
R2034 |
T3593 |
T3591 |
pobj |
tissues,throughout |
R2035 |
T3594 |
T3592 |
cc |
and,development |
R2036 |
T3595 |
T3592 |
conj |
adult,development |
R2037 |
T3596 |
T3597 |
punct |
(,data |
R2038 |
T3597 |
T3568 |
meta |
data,expressed |
R2039 |
T3598 |
T3597 |
amod |
unpublished,data |
R2040 |
T3599 |
T3597 |
punct |
),data |
R2041 |
T3600 |
T3568 |
punct |
.,expressed |
R2042 |
T3602 |
T3603 |
det |
The,cloning |
R2043 |
T3603 |
T3604 |
nsubj |
cloning,are |
R2044 |
T3605 |
T3603 |
cc |
and,cloning |
R2045 |
T3606 |
T3603 |
conj |
characterization,cloning |
R2046 |
T3607 |
T3603 |
prep |
of,cloning |
R2047 |
T3608 |
T3609 |
det |
the,family |
R2048 |
T3609 |
T3607 |
pobj |
family,of |
R2049 |
T3610 |
T3609 |
compound |
mouse,family |
R2050 |
T3611 |
T3609 |
compound |
Acdp,family |
R2051 |
T3612 |
T3609 |
compound |
gene,family |
R2052 |
T3613 |
T3614 |
det |
a,step |
R2053 |
T3614 |
T3604 |
attr |
step,are |
R2054 |
T3615 |
T3616 |
advmod |
very,important |
R2055 |
T3616 |
T3614 |
amod |
important,step |
R2056 |
T3617 |
T3614 |
prep |
towards,step |
R2057 |
T3618 |
T3619 |
det |
the,elucidation |
R2058 |
T3619 |
T3617 |
pobj |
elucidation,towards |
R2059 |
T3620 |
T3619 |
prep |
of,elucidation |
R2060 |
T3621 |
T3622 |
det |
the,functions |
R2061 |
T3622 |
T3620 |
pobj |
functions,of |
R2062 |
T3623 |
T3622 |
prep |
of,functions |
R2063 |
T3624 |
T3625 |
det |
this,family |
R2064 |
T3625 |
T3623 |
pobj |
family,of |
R2065 |
T3626 |
T3625 |
amod |
multigene,family |
R2066 |
T3627 |
T3604 |
punct |
.,are |
R2067 |
T3629 |
T3630 |
compound |
Sequence,analyses |
R2068 |
T3630 |
T3632 |
nsubj |
analyses,revealed |
R2069 |
T3631 |
T3630 |
compound |
homology,analyses |
R2070 |
T3633 |
T3634 |
mark |
that,shared |
R2071 |
T3634 |
T3632 |
ccomp |
shared,revealed |
R2072 |
T3635 |
T3636 |
compound |
Acdp,proteins |
R2073 |
T3636 |
T3634 |
nsubj |
proteins,shared |
R2074 |
T3637 |
T3638 |
advmod |
very,strong |
R2075 |
T3638 |
T3639 |
amod |
strong,homologies |
R2076 |
T3639 |
T3634 |
dobj |
homologies,shared |
R2077 |
T3640 |
T3639 |
compound |
AA,homologies |
R2078 |
T3641 |
T3639 |
prep |
to,homologies |
R2079 |
T3642 |
T3643 |
det |
the,protein |
R2080 |
T3643 |
T3641 |
pobj |
protein,to |
R2081 |
T3644 |
T3643 |
compound |
bacteria,protein |
R2082 |
T3645 |
T3643 |
compound |
CorC,protein |
R2083 |
T3646 |
T3643 |
cc |
and,protein |
R2084 |
T3647 |
T3648 |
compound |
yeast,protein |
R2085 |
T3648 |
T3643 |
conj |
protein,protein |
R2086 |
T3649 |
T3648 |
compound |
Amip3,protein |
R2087 |
T3650 |
T3632 |
punct |
.,revealed |
R2088 |
T3652 |
T3653 |
nsubj |
CorA,belong |
R2089 |
T3654 |
T3652 |
punct |
", ",CorA |
R2090 |
T3655 |
T3652 |
conj |
B,CorA |
R2091 |
T3656 |
T3655 |
punct |
", ",B |
R2092 |
T3657 |
T3655 |
conj |
C,B |
R2093 |
T3658 |
T3657 |
cc |
and,C |
R2094 |
T3659 |
T3657 |
conj |
D,C |
R2095 |
T3660 |
T3653 |
prep |
to,belong |
R2096 |
T3661 |
T3662 |
det |
a,family |
R2097 |
T3662 |
T3660 |
pobj |
family,to |
R2098 |
T3663 |
T3662 |
compound |
protein,family |
R2099 |
T3664 |
T3662 |
acl |
involved,family |
R2100 |
T3665 |
T3664 |
prep |
in,involved |
R2101 |
T3666 |
T3667 |
preconj |
both,influx |
R2102 |
T3667 |
T3665 |
pobj |
influx,in |
R2103 |
T3668 |
T3667 |
cc |
and,influx |
R2104 |
T3669 |
T3667 |
conj |
efflux,influx |
R2105 |
T3670 |
T3667 |
prep |
of,influx |
R2106 |
T3671 |
T3670 |
pobj |
magnesium,of |
R2107 |
T3672 |
T3671 |
cc |
and,magnesium |
R2108 |
T3673 |
T3671 |
conj |
cobalt,magnesium |
R2109 |
T3674 |
T3653 |
punct |
.,belong |
R2110 |
T3676 |
T3677 |
nsubjpass |
It,shown |
R2111 |
T3678 |
T3677 |
aux |
has,shown |
R2112 |
T3679 |
T3677 |
auxpass |
been,shown |
R2113 |
T3680 |
T3681 |
mark |
that,confer |
R2114 |
T3681 |
T3677 |
ccomp |
confer,shown |
R2115 |
T3682 |
T3683 |
compound |
CorA,mutants |
R2116 |
T3683 |
T3681 |
nsubj |
mutants,confer |
R2117 |
T3684 |
T3681 |
dobj |
resistance,confer |
R2118 |
T3685 |
T3684 |
prep |
to,resistance |
R2119 |
T3686 |
T3687 |
compound |
cobalt,toxicity |
R2120 |
T3687 |
T3685 |
pobj |
toxicity,to |
R2121 |
T3688 |
T3689 |
punct |
[,9 |
R2122 |
T3689 |
T3677 |
parataxis |
9,shown |
R2123 |
T3690 |
T3689 |
punct |
],9 |
R2124 |
T3691 |
T3677 |
punct |
.,shown |
R2125 |
T3693 |
T3694 |
nsubj |
Amip3,appears |
R2126 |
T3695 |
T3696 |
aux |
to,be |
R2127 |
T3696 |
T3694 |
xcomp |
be,appears |
R2128 |
T3697 |
T3698 |
det |
a,homologous |
R2129 |
T3698 |
T3696 |
attr |
homologous,be |
R2130 |
T3699 |
T3698 |
prep |
to,homologous |
R2131 |
T3700 |
T3701 |
compound |
CorC,protein |
R2132 |
T3701 |
T3699 |
pobj |
protein,to |
R2133 |
T3702 |
T3703 |
dep |
which,involved |
R2134 |
T3703 |
T3701 |
relcl |
involved,protein |
R2135 |
T3704 |
T3703 |
auxpass |
is,involved |
R2136 |
T3705 |
T3703 |
prep |
in,involved |
R2137 |
T3706 |
T3705 |
pobj |
efflux,in |
R2138 |
T3707 |
T3706 |
prep |
of,efflux |
R2139 |
T3708 |
T3707 |
pobj |
magnesium,of |
R2140 |
T3709 |
T3708 |
cc |
and,magnesium |
R2141 |
T3710 |
T3708 |
conj |
cobalt,magnesium |
R2142 |
T3711 |
T3703 |
prep |
in,involved |
R2143 |
T3712 |
T3711 |
pobj |
bacteria,in |
R2144 |
T3713 |
T3694 |
punct |
.,appears |
R2145 |
T3715 |
T3716 |
compound |
Amip3,mutants |
R2146 |
T3716 |
T3717 |
nsubj |
mutants,confer |
R2147 |
T3718 |
T3717 |
dobj |
resistant,confer |
R2148 |
T3719 |
T3718 |
prep |
to,resistant |
R2149 |
T3720 |
T3721 |
compound |
copper,toxicity |
R2150 |
T3721 |
T3719 |
pobj |
toxicity,to |
R2151 |
T3722 |
T3717 |
punct |
.,confer |
R2152 |
T3724 |
T3725 |
nsubj |
Acdp,possess |
R2153 |
T3726 |
T3725 |
dep |
proteins,possess |
R2154 |
T3727 |
T3725 |
advmod |
also,possess |
R2155 |
T3728 |
T3729 |
det |
the,domains |
R2156 |
T3729 |
T3725 |
dobj |
domains,possess |
R2157 |
T3730 |
T3731 |
dep |
that,found |
R2158 |
T3731 |
T3729 |
relcl |
found,domains |
R2159 |
T3732 |
T3731 |
auxpass |
are,found |
R2160 |
T3733 |
T3731 |
prep |
in,found |
R2161 |
T3734 |
T3735 |
nmod |
bacteria,CorC |
R2162 |
T3735 |
T3736 |
nmod |
CorC,proteins |
R2163 |
T3736 |
T3733 |
pobj |
proteins,in |
R2164 |
T3737 |
T3735 |
cc |
and,CorC |
R2165 |
T3738 |
T3739 |
compound |
yeast,Amip3 |
R2166 |
T3739 |
T3735 |
conj |
Amip3,CorC |
R2167 |
T3740 |
T3729 |
punct |
", ",domains |
R2168 |
T3741 |
T3742 |
amod |
such,as |
R2169 |
T3742 |
T3729 |
prep |
as,domains |
R2170 |
T3743 |
T3744 |
det |
the,domains |
R2171 |
T3744 |
T3742 |
pobj |
domains,as |
R2172 |
T3745 |
T3744 |
compound |
CBS,domains |
R2173 |
T3746 |
T3744 |
punct |
", ",domains |
R2174 |
T3747 |
T3748 |
compound |
DUF21,domain |
R2175 |
T3748 |
T3744 |
conj |
domain,domains |
R2176 |
T3749 |
T3748 |
cc |
and,domain |
R2177 |
T3750 |
T3751 |
compound |
transmembrane,domains |
R2178 |
T3751 |
T3748 |
conj |
domains,domain |
R2179 |
T3752 |
T3725 |
punct |
.,possess |
R2180 |
T3754 |
T3755 |
prep |
In,found |
R2181 |
T3756 |
T3754 |
pobj |
addition,In |
R2182 |
T3757 |
T3755 |
punct |
", ",found |
R2183 |
T3758 |
T3759 |
det |
a,domain |
R2184 |
T3759 |
T3755 |
nsubjpass |
domain,found |
R2185 |
T3760 |
T3761 |
npadvmod |
cNMP,binding |
R2186 |
T3761 |
T3759 |
amod |
binding,domain |
R2187 |
T3762 |
T3761 |
punct |
-,binding |
R2188 |
T3763 |
T3755 |
auxpass |
was,found |
R2189 |
T3764 |
T3755 |
prep |
in,found |
R2190 |
T3765 |
T3766 |
det |
all,proteins |
R2191 |
T3766 |
T3764 |
pobj |
proteins,in |
R2192 |
T3767 |
T3766 |
compound |
Acdp,proteins |
R2193 |
T3768 |
T3755 |
punct |
", ",found |
R2194 |
T3769 |
T3770 |
dep |
which,is |
R2195 |
T3770 |
T3755 |
ccomp |
is,found |
R2196 |
T3771 |
T3770 |
advmod |
usually,is |
R2197 |
T3772 |
T3770 |
acomp |
present,is |
R2198 |
T3773 |
T3770 |
prep |
in,is |
R2199 |
T3774 |
T3775 |
compound |
ion,channels |
R2200 |
T3775 |
T3773 |
pobj |
channels,in |
R2201 |
T3776 |
T3775 |
cc |
and,channels |
R2202 |
T3777 |
T3778 |
nmod |
cNMP,kinases |
R2203 |
T3778 |
T3775 |
conj |
kinases,channels |
R2204 |
T3779 |
T3777 |
punct |
-,cNMP |
R2205 |
T3780 |
T3777 |
amod |
dependent,cNMP |
R2206 |
T3781 |
T3782 |
punct |
[,10 |
R2207 |
T3782 |
T3755 |
parataxis |
10,found |
R2208 |
T3783 |
T3784 |
punct |
-,13 |
R2209 |
T3784 |
T3782 |
prep |
13,10 |
R2210 |
T3785 |
T3782 |
punct |
],10 |
R2211 |
T3786 |
T3755 |
punct |
.,found |
R2212 |
T3788 |
T3789 |
advcl |
Using,shown |
R2213 |
T3790 |
T3788 |
dobj |
antibody,Using |
R2214 |
T3791 |
T3790 |
acl |
produced,antibody |
R2215 |
T3792 |
T3791 |
agent |
by,produced |
R2216 |
T3793 |
T3794 |
nmod |
Acdp1,peptide |
R2217 |
T3794 |
T3792 |
pobj |
peptide,by |
R2218 |
T3795 |
T3796 |
npadvmod |
C,terminal |
R2219 |
T3796 |
T3794 |
amod |
terminal,peptide |
R2220 |
T3797 |
T3796 |
punct |
-,terminal |
R2221 |
T3798 |
T3789 |
punct |
", ",shown |
R2222 |
T3799 |
T3789 |
nsubj |
we,shown |
R2223 |
T3800 |
T3789 |
aux |
have,shown |
R2224 |
T3801 |
T3802 |
mark |
that,localized |
R2225 |
T3802 |
T3789 |
ccomp |
localized,shown |
R2226 |
T3803 |
T3802 |
nsubjpass |
Acdp1,localized |
R2227 |
T3804 |
T3802 |
auxpass |
is,localized |
R2228 |
T3805 |
T3802 |
advmod |
predominantly,localized |
R2229 |
T3806 |
T3802 |
prep |
on,localized |
R2230 |
T3807 |
T3808 |
det |
the,membrane |
R2231 |
T3808 |
T3806 |
pobj |
membrane,on |
R2232 |
T3809 |
T3808 |
compound |
plasma,membrane |
R2233 |
T3810 |
T3802 |
prep |
in,localized |
R2234 |
T3811 |
T3812 |
compound |
hippocampus,neurons |
R2235 |
T3812 |
T3810 |
pobj |
neurons,in |
R2236 |
T3813 |
T3789 |
punct |
.,shown |
R2237 |
T3815 |
T3816 |
prep |
In,found |
R2238 |
T3817 |
T3818 |
poss |
our,study |
R2239 |
T3818 |
T3815 |
pobj |
study,In |
R2240 |
T3819 |
T3818 |
amod |
previous,study |
R2241 |
T3820 |
T3816 |
punct |
", ",found |
R2242 |
T3821 |
T3816 |
nsubj |
we,found |
R2243 |
T3822 |
T3823 |
amod |
human,proteins |
R2244 |
T3823 |
T3825 |
nsubjpass |
proteins,localized |
R2245 |
T3824 |
T3823 |
compound |
ACDP,proteins |
R2246 |
T3825 |
T3816 |
advcl |
localized,found |
R2247 |
T3826 |
T3825 |
auxpass |
are,localized |
R2248 |
T3827 |
T3825 |
advmod |
predominantly,localized |
R2249 |
T3828 |
T3825 |
prep |
in,localized |
R2250 |
T3829 |
T3830 |
det |
the,nucleus |
R2251 |
T3830 |
T3828 |
pobj |
nucleus,in |
R2252 |
T3831 |
T3825 |
prep |
in,localized |
R2253 |
T3832 |
T3833 |
compound |
HeLa,cells |
R2254 |
T3833 |
T3831 |
pobj |
cells,in |
R2255 |
T3834 |
T3835 |
punct |
[,1 |
R2256 |
T3835 |
T3816 |
parataxis |
1,found |
R2257 |
T3836 |
T3835 |
punct |
],1 |
R2258 |
T3837 |
T3816 |
punct |
.,found |
R2259 |
T3839 |
T3840 |
det |
The,discrepancy |
R2260 |
T3840 |
T3841 |
nsubjpass |
discrepancy,caused |
R2261 |
T3842 |
T3840 |
prep |
for,discrepancy |
R2262 |
T3843 |
T3844 |
compound |
Acdp,localization |
R2263 |
T3844 |
T3842 |
pobj |
localization,for |
R2264 |
T3845 |
T3844 |
prep |
in,localization |
R2265 |
T3846 |
T3847 |
amod |
neuronal,cells |
R2266 |
T3847 |
T3845 |
pobj |
cells,in |
R2267 |
T3848 |
T3841 |
aux |
could,caused |
R2268 |
T3849 |
T3841 |
auxpass |
be,caused |
R2269 |
T3850 |
T3841 |
agent |
by,caused |
R2270 |
T3851 |
T3850 |
pobj |
non-specificity,by |
R2271 |
T3852 |
T3851 |
prep |
for,non-specificity |
R2272 |
T3853 |
T3854 |
amod |
previous,antibody |
R2273 |
T3854 |
T3852 |
pobj |
antibody,for |
R2274 |
T3855 |
T3856 |
dep |
which,produced |
R2275 |
T3856 |
T3854 |
relcl |
produced,antibody |
R2276 |
T3857 |
T3856 |
auxpass |
was,produced |
R2277 |
T3858 |
T3856 |
prep |
by,produced |
R2278 |
T3859 |
T3860 |
det |
the,domain |
R2279 |
T3860 |
T3858 |
pobj |
domain,by |
R2280 |
T3861 |
T3860 |
amod |
recombinant,domain |
R2281 |
T3862 |
T3860 |
compound |
ACD,domain |
R2282 |
T3863 |
T3851 |
punct |
", ",non-specificity |
R2283 |
T3864 |
T3851 |
cc |
or,non-specificity |
R2284 |
T3865 |
T3866 |
amod |
different,cells |
R2285 |
T3866 |
T3851 |
conj |
cells,non-specificity |
R2286 |
T3867 |
T3866 |
acl |
used,cells |
R2287 |
T3868 |
T3841 |
punct |
.,caused |
R2288 |
T3870 |
T3871 |
prep |
In,recognizes |
R2289 |
T3872 |
T3873 |
amod |
current,study |
R2290 |
T3873 |
T3870 |
pobj |
study,In |
R2291 |
T3874 |
T3871 |
punct |
", ",recognizes |
R2292 |
T3875 |
T3876 |
det |
the,antibody |
R2293 |
T3876 |
T3871 |
nsubj |
antibody,recognizes |
R2294 |
T3877 |
T3876 |
compound |
Acdp1,antibody |
R2295 |
T3878 |
T3879 |
compound |
C,terminus |
R2296 |
T3879 |
T3876 |
compound |
terminus,antibody |
R2297 |
T3880 |
T3879 |
punct |
-,terminus |
R2298 |
T3881 |
T3871 |
advmod |
only,recognizes |
R2299 |
T3882 |
T3871 |
dobj |
Acdp1,recognizes |
R2300 |
T3883 |
T3871 |
prep |
in,recognizes |
R2301 |
T3884 |
T3885 |
compound |
brain,tissue |
R2302 |
T3885 |
T3886 |
compound |
tissue,extracts |
R2303 |
T3886 |
T3883 |
pobj |
extracts,in |
R2304 |
T3887 |
T3888 |
advmod |
as,as |
R2305 |
T3888 |
T3883 |
cc |
as,in |
R2306 |
T3889 |
T3888 |
advmod |
well,as |
R2307 |
T3890 |
T3883 |
conj |
in,in |
R2308 |
T3891 |
T3892 |
nmod |
HEK293,lysates |
R2309 |
T3892 |
T3890 |
pobj |
lysates,in |
R2310 |
T3893 |
T3891 |
punct |
", ",HEK293 |
R2311 |
T3894 |
T3891 |
conj |
3T3,HEK293 |
R2312 |
T3895 |
T3894 |
cc |
and,3T3 |
R2313 |
T3896 |
T3894 |
conj |
PC12,3T3 |
R2314 |
T3897 |
T3892 |
compound |
cell,lysates |
R2315 |
T3898 |
T3871 |
punct |
", ",recognizes |
R2316 |
T3899 |
T3871 |
advcl |
suggesting,recognizes |
R2317 |
T3900 |
T3901 |
det |
the,specificity |
R2318 |
T3901 |
T3899 |
dobj |
specificity,suggesting |
R2319 |
T3902 |
T3901 |
prep |
of,specificity |
R2320 |
T3903 |
T3904 |
det |
the,antibody |
R2321 |
T3904 |
T3902 |
pobj |
antibody,of |
R2322 |
T3905 |
T3871 |
punct |
.,recognizes |
R2323 |
T3907 |
T3908 |
poss |
Our,observations |
R2324 |
T3908 |
T3909 |
nsubj |
observations,suggested |
R2325 |
T3910 |
T3911 |
mark |
that,involved |
R2326 |
T3911 |
T3909 |
ccomp |
involved,suggested |
R2327 |
T3912 |
T3911 |
nsubjpass |
Acdp,involved |
R2328 |
T3913 |
T3911 |
aux |
might,involved |
R2329 |
T3914 |
T3911 |
auxpass |
be,involved |
R2330 |
T3915 |
T3911 |
prep |
in,involved |
R2331 |
T3916 |
T3917 |
compound |
ion,transport |
R2332 |
T3917 |
T3915 |
pobj |
transport,in |
R2333 |
T3918 |
T3911 |
prep |
in,involved |
R2334 |
T3919 |
T3920 |
amod |
mammalian,cells |
R2335 |
T3920 |
T3918 |
pobj |
cells,in |
R2336 |
T3921 |
T3909 |
punct |
.,suggested |
R2337 |
T3923 |
T3924 |
advmod |
However,needed |
R2338 |
T3925 |
T3924 |
punct |
", ",needed |
R2339 |
T3926 |
T3927 |
advmod |
more,detailed |
R2340 |
T3927 |
T3928 |
amod |
detailed,studies |
R2341 |
T3928 |
T3924 |
nsubjpass |
studies,needed |
R2342 |
T3929 |
T3928 |
amod |
functional,studies |
R2343 |
T3930 |
T3924 |
auxpass |
are,needed |
R2344 |
T3931 |
T3932 |
aux |
to,demonstrate |
R2345 |
T3932 |
T3924 |
advcl |
demonstrate,needed |
R2346 |
T3933 |
T3934 |
det |
the,functions |
R2347 |
T3934 |
T3932 |
dobj |
functions,demonstrate |
R2348 |
T3935 |
T3934 |
amod |
real,functions |
R2349 |
T3936 |
T3934 |
prep |
of,functions |
R2350 |
T3937 |
T3938 |
det |
these,proteins |
R2351 |
T3938 |
T3936 |
pobj |
proteins,of |
R2352 |
T3939 |
T3924 |
punct |
.,needed |
R2353 |
T4051 |
T4052 |
poss |
Our,work |
R2354 |
T4052 |
T4054 |
nsubj |
work,described |
R2355 |
T4053 |
T4052 |
amod |
previous,work |
R2356 |
T4055 |
T4054 |
aux |
has,described |
R2357 |
T4056 |
T4057 |
amod |
human,genes |
R2358 |
T4057 |
T4054 |
dobj |
genes,described |
R2359 |
T4058 |
T4057 |
compound |
ACDP,genes |
R2360 |
T4059 |
T4060 |
punct |
[,1 |
R2361 |
T4060 |
T4054 |
parataxis |
1,described |
R2362 |
T4061 |
T4060 |
punct |
],1 |
R2363 |
T4062 |
T4054 |
punct |
.,described |
R2364 |
T4064 |
T4065 |
det |
The,information |
R2365 |
T4065 |
T4067 |
nsubj |
information,includes |
R2366 |
T4066 |
T4065 |
amod |
new,information |
R2367 |
T4067 |
T4072 |
ccomp |
includes,is |
R2368 |
T4068 |
T4065 |
prep |
of,information |
R2369 |
T4069 |
T4070 |
det |
the,work |
R2370 |
T4070 |
T4068 |
pobj |
work,of |
R2371 |
T4071 |
T4070 |
amod |
current,work |
R2372 |
T4073 |
T4067 |
punct |
: ,includes |
R2373 |
T4074 |
T4072 |
meta |
1,is |
R2374 |
T4075 |
T4074 |
punct |
),1 |
R2375 |
T4076 |
T4074 |
punct |
.,1 |
R2376 |
T4077 |
T4072 |
nsubj |
It,is |
R2377 |
T4078 |
T4079 |
det |
the,time |
R2378 |
T4079 |
T4072 |
attr |
time,is |
R2379 |
T4080 |
T4079 |
amod |
first,time |
R2380 |
T4081 |
T4082 |
aux |
to,report |
R2381 |
T4082 |
T4079 |
advcl |
report,time |
R2382 |
T4083 |
T4084 |
det |
the,existence |
R2383 |
T4084 |
T4082 |
dobj |
existence,report |
R2384 |
T4085 |
T4084 |
prep |
of,existence |
R2385 |
T4086 |
T4087 |
amod |
multiple,genes |
R2386 |
T4087 |
T4085 |
pobj |
genes,of |
R2387 |
T4088 |
T4087 |
compound |
Acdp,genes |
R2388 |
T4089 |
T4082 |
prep |
in,report |
R2389 |
T4090 |
T4091 |
amod |
other,mammals |
R2390 |
T4091 |
T4089 |
pobj |
mammals,in |
R2391 |
T4092 |
T4091 |
prep |
in,mammals |
R2392 |
T4093 |
T4092 |
pobj |
addition,in |
R2393 |
T4094 |
T4093 |
prep |
to,addition |
R2394 |
T4095 |
T4094 |
pobj |
human,to |
R2395 |
T4096 |
T4072 |
punct |
", ",is |
R2396 |
T4097 |
T4098 |
mark |
while,appears |
R2397 |
T4098 |
T4072 |
advcl |
appears,is |
R2398 |
T4099 |
T4098 |
nsubj |
Acdp,appears |
R2399 |
T4100 |
T4101 |
aux |
to,be |
R2400 |
T4101 |
T4098 |
xcomp |
be,appears |
R2401 |
T4102 |
T4103 |
det |
a,gene |
R2402 |
T4103 |
T4101 |
attr |
gene,be |
R2403 |
T4104 |
T4103 |
amod |
single,gene |
R2404 |
T4105 |
T4103 |
compound |
copy,gene |
R2405 |
T4106 |
T4103 |
prep |
in,gene |
R2406 |
T4107 |
T4108 |
amod |
lower,organisms |
R2407 |
T4108 |
T4106 |
pobj |
organisms,in |
R2408 |
T4109 |
T4110 |
amod |
such,as |
R2409 |
T4110 |
T4101 |
prep |
as,be |
R2410 |
T4111 |
T4110 |
prep |
in,as |
R2411 |
T4112 |
T4113 |
compound |
C.,elegans |
R2412 |
T4113 |
T4111 |
pobj |
elegans,in |
R2413 |
T4114 |
T4113 |
punct |
", ",elegans |
R2414 |
T4115 |
T4113 |
conj |
yeasts,elegans |
R2415 |
T4116 |
T4115 |
cc |
and,yeasts |
R2416 |
T4117 |
T4115 |
conj |
bacteria,yeasts |
R2417 |
T4118 |
T4072 |
punct |
.,is |
R2418 |
T4120 |
T4121 |
nsubj |
We,suggested |
R2419 |
T4121 |
T4124 |
ccomp |
suggested,generated |
R2420 |
T4122 |
T4121 |
aux |
have,suggested |
R2421 |
T4123 |
T4121 |
advmod |
also,suggested |
R2422 |
T4125 |
T4126 |
det |
the,relationships |
R2423 |
T4126 |
T4121 |
dobj |
relationships,suggested |
R2424 |
T4127 |
T4126 |
amod |
evolutionary,relationships |
R2425 |
T4128 |
T4126 |
prep |
of,relationships |
R2426 |
T4129 |
T4130 |
compound |
Acdp,genes |
R2427 |
T4130 |
T4128 |
pobj |
genes,of |
R2428 |
T4131 |
T4130 |
prep |
in,genes |
R2429 |
T4132 |
T4133 |
amod |
different,species |
R2430 |
T4133 |
T4131 |
pobj |
species,in |
R2431 |
T4134 |
T4135 |
punct |
(,tree |
R2432 |
T4135 |
T4121 |
parataxis |
tree,suggested |
R2433 |
T4136 |
T4135 |
amod |
phylogenetic,tree |
R2434 |
T4137 |
T4135 |
punct |
),tree |
R2435 |
T4138 |
T4124 |
punct |
;,generated |
R2436 |
T4139 |
T4140 |
meta |
2,are |
R2437 |
T4140 |
T4124 |
ccomp |
are,generated |
R2438 |
T4141 |
T4139 |
punct |
),2 |
R2439 |
T4142 |
T4139 |
punct |
.,2 |
R2440 |
T4143 |
T4144 |
amod |
Molecular,cloning |
R2441 |
T4144 |
T4140 |
nsubj |
cloning,are |
R2442 |
T4145 |
T4144 |
cc |
and,cloning |
R2443 |
T4146 |
T4144 |
conj |
characterization,cloning |
R2444 |
T4147 |
T4144 |
prep |
of,cloning |
R2445 |
T4148 |
T4149 |
amod |
murine,family |
R2446 |
T4149 |
T4147 |
pobj |
family,of |
R2447 |
T4150 |
T4149 |
compound |
Acdp,family |
R2448 |
T4151 |
T4149 |
compound |
gene,family |
R2449 |
T4152 |
T4140 |
acomp |
essential,are |
R2450 |
T4153 |
T4140 |
prep |
for,are |
R2451 |
T4154 |
T4153 |
pobj |
study,for |
R2452 |
T4155 |
T4154 |
prep |
of,study |
R2453 |
T4156 |
T4157 |
det |
this,family |
R2454 |
T4157 |
T4155 |
pobj |
family,of |
R2455 |
T4158 |
T4157 |
amod |
novel,family |
R2456 |
T4159 |
T4157 |
compound |
gene,family |
R2457 |
T4160 |
T4154 |
prep |
in,study |
R2458 |
T4161 |
T4162 |
compound |
animal,model |
R2459 |
T4162 |
T4160 |
pobj |
model,in |
R2460 |
T4163 |
T4153 |
punct |
", ",for |
R2461 |
T4164 |
T4165 |
advmod |
e.g.,for |
R2462 |
T4165 |
T4153 |
prep |
for,for |
R2463 |
T4166 |
T4165 |
pobj |
generation,for |
R2464 |
T4167 |
T4166 |
prep |
of,generation |
R2465 |
T4168 |
T4169 |
nmod |
knockout,models |
R2466 |
T4169 |
T4167 |
pobj |
models,of |
R2467 |
T4170 |
T4168 |
cc |
or,knockout |
R2468 |
T4171 |
T4168 |
conj |
transgenic,knockout |
R2469 |
T4172 |
T4124 |
punct |
;,generated |
R2470 |
T4173 |
T4174 |
meta |
3,demonstrated |
R2471 |
T4174 |
T4124 |
ccomp |
demonstrated,generated |
R2472 |
T4175 |
T4173 |
punct |
),3 |
R2473 |
T4176 |
T4173 |
punct |
.,3 |
R2474 |
T4177 |
T4174 |
nsubj |
We,demonstrated |
R2475 |
T4178 |
T4174 |
aux |
have,demonstrated |
R2476 |
T4179 |
T4180 |
preconj |
both,DNA |
R2477 |
T4180 |
T4181 |
nmod |
DNA,conservations |
R2478 |
T4181 |
T4174 |
dobj |
conservations,demonstrated |
R2479 |
T4182 |
T4180 |
cc |
and,DNA |
R2480 |
T4183 |
T4184 |
compound |
amino,acid |
R2481 |
T4184 |
T4180 |
conj |
acid,DNA |
R2482 |
T4185 |
T4181 |
prep |
between,conservations |
R2483 |
T4186 |
T4185 |
pobj |
mouse,between |
R2484 |
T4187 |
T4186 |
cc |
and,mouse |
R2485 |
T4188 |
T4186 |
conj |
human,mouse |
R2486 |
T4189 |
T4174 |
prep |
for,demonstrated |
R2487 |
T4190 |
T4191 |
det |
each,gene |
R2488 |
T4191 |
T4189 |
pobj |
gene,for |
R2489 |
T4192 |
T4191 |
compound |
Acdp,gene |
R2490 |
T4193 |
T4191 |
cc |
and,gene |
R2491 |
T4194 |
T4195 |
det |
the,family |
R2492 |
T4195 |
T4191 |
conj |
family,gene |
R2493 |
T4196 |
T4195 |
amod |
whole,family |
R2494 |
T4197 |
T4195 |
compound |
Acdp,family |
R2495 |
T4198 |
T4195 |
compound |
gene,family |
R2496 |
T4199 |
T4191 |
punct |
", ",gene |
R2497 |
T4200 |
T4201 |
dep |
which,provide |
R2498 |
T4201 |
T4191 |
relcl |
provide,gene |
R2499 |
T4202 |
T4203 |
amod |
important,information |
R2500 |
T4203 |
T4201 |
dobj |
information,provide |
R2501 |
T4204 |
T4203 |
prep |
for,information |
R2502 |
T4205 |
T4206 |
det |
the,possibility |
R2503 |
T4206 |
T4204 |
pobj |
possibility,for |
R2504 |
T4207 |
T4206 |
prep |
of,possibility |
R2505 |
T4208 |
T4209 |
amod |
functional,redundancy |
R2506 |
T4209 |
T4207 |
pobj |
redundancy,of |
R2507 |
T4210 |
T4209 |
cc |
or,redundancy |
R2508 |
T4211 |
T4209 |
conj |
overlap,redundancy |
R2509 |
T4212 |
T4209 |
prep |
between,redundancy |
R2510 |
T4213 |
T4214 |
compound |
Acdp,members |
R2511 |
T4214 |
T4212 |
pobj |
members,between |
R2512 |
T4215 |
T4124 |
punct |
;,generated |
R2513 |
T4216 |
T4124 |
meta |
4,generated |
R2514 |
T4217 |
T4216 |
punct |
),4 |
R2515 |
T4218 |
T4216 |
punct |
.,4 |
R2516 |
T4219 |
T4124 |
nsubj |
We,generated |
R2517 |
T4220 |
T4124 |
aux |
have,generated |
R2518 |
T4221 |
T4124 |
dobj |
antibodies,generated |
R2519 |
T4222 |
T4221 |
amod |
specific,antibodies |
R2520 |
T4223 |
T4222 |
prep |
for,specific |
R2521 |
T4224 |
T4223 |
pobj |
Acdp1,for |
R2522 |
T4225 |
T4224 |
cc |
and,Acdp1 |
R2523 |
T4226 |
T4227 |
det |
all,proteins |
R2524 |
T4227 |
T4224 |
conj |
proteins,Acdp1 |
R2525 |
T4228 |
T4227 |
compound |
Acdp,proteins |
R2526 |
T4229 |
T4124 |
punct |
.,generated |
R2527 |
T4231 |
T4232 |
det |
The,antibody |
R2528 |
T4232 |
T4237 |
nsubj |
antibody,appears |
R2529 |
T4233 |
T4232 |
compound |
Acdp1,antibody |
R2530 |
T4234 |
T4235 |
compound |
C,terminus |
R2531 |
T4235 |
T4232 |
compound |
terminus,antibody |
R2532 |
T4236 |
T4235 |
punct |
-,terminus |
R2533 |
T4238 |
T4239 |
aux |
to,recognize |
R2534 |
T4239 |
T4237 |
xcomp |
recognize,appears |
R2535 |
T4240 |
T4239 |
advmod |
specifically,recognize |
R2536 |
T4241 |
T4239 |
dobj |
Acdp1,recognize |
R2537 |
T4242 |
T4237 |
punct |
.,appears |
R2538 |
T4244 |
T4245 |
advcl |
Using,demonstrated |
R2539 |
T4246 |
T4247 |
det |
this,antibody |
R2540 |
T4247 |
T4244 |
dobj |
antibody,Using |
R2541 |
T4248 |
T4245 |
punct |
", ",demonstrated |
R2542 |
T4249 |
T4245 |
nsubj |
we,demonstrated |
R2543 |
T4250 |
T4245 |
aux |
have,demonstrated |
R2544 |
T4251 |
T4252 |
mark |
that,localized |
R2545 |
T4252 |
T4245 |
ccomp |
localized,demonstrated |
R2546 |
T4253 |
T4252 |
nsubjpass |
Acdp1,localized |
R2547 |
T4254 |
T4252 |
auxpass |
is,localized |
R2548 |
T4255 |
T4252 |
advmod |
predominantly,localized |
R2549 |
T4256 |
T4252 |
prep |
on,localized |
R2550 |
T4257 |
T4258 |
det |
the,membrane |
R2551 |
T4258 |
T4256 |
pobj |
membrane,on |
R2552 |
T4259 |
T4258 |
compound |
plasma,membrane |
R2553 |
T4260 |
T4252 |
prep |
in,localized |
R2554 |
T4261 |
T4262 |
compound |
hippocampus,neurons |
R2555 |
T4262 |
T4260 |
pobj |
neurons,in |
R2556 |
T4263 |
T4245 |
punct |
.,demonstrated |
R2557 |
T4265 |
T4266 |
det |
These,results |
R2558 |
T4266 |
T4267 |
nsubj |
results,represent |
R2559 |
T4268 |
T4269 |
det |
an,step |
R2560 |
T4269 |
T4267 |
dobj |
step,represent |
R2561 |
T4270 |
T4269 |
amod |
important,step |
R2562 |
T4271 |
T4269 |
prep |
towards,step |
R2563 |
T4272 |
T4273 |
det |
the,characterization |
R2564 |
T4273 |
T4271 |
pobj |
characterization,towards |
R2565 |
T4274 |
T4273 |
prep |
of,characterization |
R2566 |
T4275 |
T4274 |
pobj |
functions,of |
R2567 |
T4276 |
T4273 |
prep |
for,characterization |
R2568 |
T4277 |
T4278 |
det |
the,family |
R2569 |
T4278 |
T4276 |
pobj |
family,for |
R2570 |
T4279 |
T4278 |
compound |
Acdp,family |
R2571 |
T4280 |
T4278 |
compound |
gene,family |
R2572 |
T4281 |
T4267 |
punct |
.,represent |
R2573 |
T4392 |
T4393 |
compound |
cDNA,cloning |
R2574 |
T4395 |
T4396 |
compound |
cDNA,cloning |
R2575 |
T4396 |
T4397 |
nsubjpass |
cloning,performed |
R2576 |
T4398 |
T4396 |
prep |
of,cloning |
R2577 |
T4399 |
T4400 |
det |
the,family |
R2578 |
T4400 |
T4398 |
pobj |
family,of |
R2579 |
T4401 |
T4400 |
compound |
Acdp,family |
R2580 |
T4402 |
T4400 |
compound |
gene,family |
R2581 |
T4403 |
T4397 |
auxpass |
was,performed |
R2582 |
T4404 |
T4397 |
prep |
based,performed |
R2583 |
T4405 |
T4404 |
prep |
on,based |
R2584 |
T4406 |
T4407 |
amod |
human,sequences |
R2585 |
T4407 |
T4405 |
pobj |
sequences,on |
R2586 |
T4408 |
T4407 |
compound |
homologue,sequences |
R2587 |
T4409 |
T4410 |
mark |
as,reported |
R2588 |
T4410 |
T4397 |
advcl |
reported,performed |
R2589 |
T4411 |
T4410 |
advmod |
previously,reported |
R2590 |
T4412 |
T4413 |
punct |
[,2 |
R2591 |
T4413 |
T4397 |
parataxis |
2,performed |
R2592 |
T4414 |
T4413 |
punct |
],2 |
R2593 |
T4415 |
T4397 |
punct |
.,performed |
R2594 |
T4417 |
T4418 |
advmod |
Briefly,used |
R2595 |
T4419 |
T4418 |
punct |
", ",used |
R2596 |
T4420 |
T4421 |
det |
the,cDNAs |
R2597 |
T4421 |
T4418 |
nsubjpass |
cDNAs,used |
R2598 |
T4422 |
T4421 |
amod |
human,cDNAs |
R2599 |
T4423 |
T4421 |
compound |
ACDP,cDNAs |
R2600 |
T4424 |
T4421 |
cc |
and,cDNAs |
R2601 |
T4425 |
T4426 |
amod |
predicted,sequences |
R2602 |
T4426 |
T4421 |
conj |
sequences,cDNAs |
R2603 |
T4427 |
T4426 |
compound |
AA,sequences |
R2604 |
T4428 |
T4418 |
auxpass |
were,used |
R2605 |
T4429 |
T4430 |
aux |
to,search |
R2606 |
T4430 |
T4418 |
advcl |
search,used |
R2607 |
T4431 |
T4432 |
det |
the,database |
R2608 |
T4432 |
T4430 |
dobj |
database,search |
R2609 |
T4433 |
T4432 |
compound |
mouse,database |
R2610 |
T4434 |
T4432 |
compound |
EST,database |
R2611 |
T4435 |
T4430 |
prep |
for,search |
R2612 |
T4436 |
T4437 |
compound |
EST,markers |
R2613 |
T4437 |
T4435 |
pobj |
markers,for |
R2614 |
T4438 |
T4437 |
acl |
corresponding,markers |
R2615 |
T4439 |
T4438 |
prep |
to,corresponding |
R2616 |
T4440 |
T4441 |
det |
each,member |
R2617 |
T4441 |
T4439 |
pobj |
member,to |
R2618 |
T4442 |
T4441 |
compound |
Acdp,member |
R2619 |
T4443 |
T4418 |
punct |
.,used |
R2620 |
T4445 |
T4446 |
det |
A,primer |
R2621 |
T4446 |
T4448 |
nsubjpass |
primer,used |
R2622 |
T4447 |
T4446 |
amod |
forward,primer |
R2623 |
T4449 |
T4446 |
prep |
within,primer |
R2624 |
T4450 |
T4451 |
det |
the,region |
R2625 |
T4451 |
T4449 |
pobj |
region,within |
R2626 |
T4452 |
T4451 |
amod |
human,region |
R2627 |
T4453 |
T4451 |
nmod |
ACDP,region |
R2628 |
T4454 |
T4451 |
nummod |
5,region |
R2629 |
T4455 |
T4454 |
punct |
',5 |
R2630 |
T4456 |
T4451 |
compound |
cDNA,region |
R2631 |
T4457 |
T4451 |
compound |
coding,region |
R2632 |
T4458 |
T4446 |
punct |
(,primer |
R2633 |
T4459 |
T4446 |
prep |
after,primer |
R2634 |
T4460 |
T4461 |
compound |
start,codon |
R2635 |
T4461 |
T4459 |
pobj |
codon,after |
R2636 |
T4462 |
T4446 |
punct |
),primer |
R2637 |
T4463 |
T4446 |
cc |
and,primer |
R2638 |
T4464 |
T4465 |
det |
a,primer |
R2639 |
T4465 |
T4446 |
conj |
primer,primer |
R2640 |
T4466 |
T4465 |
nmod |
mouse,primer |
R2641 |
T4467 |
T4465 |
amod |
reverse,primer |
R2642 |
T4468 |
T4465 |
prep |
from,primer |
R2643 |
T4469 |
T4470 |
det |
the,marker |
R2644 |
T4470 |
T4468 |
pobj |
marker,from |
R2645 |
T4471 |
T4470 |
compound |
mouse,marker |
R2646 |
T4472 |
T4470 |
compound |
EST,marker |
R2647 |
T4473 |
T4448 |
auxpass |
were,used |
R2648 |
T4474 |
T4475 |
aux |
to,amplify |
R2649 |
T4475 |
T4448 |
advcl |
amplify,used |
R2650 |
T4476 |
T4477 |
det |
the,sequence |
R2651 |
T4477 |
T4475 |
dobj |
sequence,amplify |
R2652 |
T4478 |
T4477 |
compound |
homologue,sequence |
R2653 |
T4479 |
T4475 |
prep |
from,amplify |
R2654 |
T4480 |
T4481 |
compound |
mouse,cDNA |
R2655 |
T4481 |
T4479 |
pobj |
cDNA,from |
R2656 |
T4482 |
T4475 |
prep |
at,amplify |
R2657 |
T4483 |
T4484 |
advmod |
very,low |
R2658 |
T4484 |
T4485 |
amod |
low,temperature |
R2659 |
T4485 |
T4482 |
pobj |
temperature,at |
R2660 |
T4486 |
T4485 |
amod |
annealing,temperature |
R2661 |
T4487 |
T4485 |
punct |
(,temperature |
R2662 |
T4488 |
T4489 |
quantmod |
45,50 |
R2663 |
T4489 |
T4491 |
nummod |
50,°C |
R2664 |
T4490 |
T4489 |
punct |
–,50 |
R2665 |
T4491 |
T4485 |
appos |
°C,temperature |
R2666 |
T4492 |
T4448 |
punct |
),used |
R2667 |
T4493 |
T4448 |
punct |
.,used |
R2668 |
T4495 |
T4496 |
det |
A,PCR |
R2669 |
T4496 |
T4498 |
nsubjpass |
PCR,carried |
R2670 |
T4497 |
T4496 |
amod |
nested,PCR |
R2671 |
T4499 |
T4496 |
acl |
using,PCR |
R2672 |
T4500 |
T4501 |
det |
an,primer |
R2673 |
T4501 |
T4499 |
dobj |
primer,using |
R2674 |
T4502 |
T4501 |
amod |
inside,primer |
R2675 |
T4503 |
T4501 |
amod |
reverse,primer |
R2676 |
T4504 |
T4501 |
prep |
from,primer |
R2677 |
T4505 |
T4506 |
det |
the,sequence |
R2678 |
T4506 |
T4504 |
pobj |
sequence,from |
R2679 |
T4507 |
T4506 |
compound |
mouse,sequence |
R2680 |
T4508 |
T4506 |
compound |
EST,sequence |
R2681 |
T4509 |
T4501 |
cc |
and,primer |
R2682 |
T4510 |
T4511 |
det |
the,primer |
R2683 |
T4511 |
T4501 |
conj |
primer,primer |
R2684 |
T4512 |
T4511 |
amod |
same,primer |
R2685 |
T4513 |
T4511 |
amod |
human,primer |
R2686 |
T4514 |
T4511 |
amod |
forward,primer |
R2687 |
T4515 |
T4498 |
auxpass |
was,carried |
R2688 |
T4516 |
T4498 |
advmod |
then,carried |
R2689 |
T4517 |
T4498 |
prt |
out,carried |
R2690 |
T4518 |
T4519 |
aux |
to,amplify |
R2691 |
T4519 |
T4498 |
advcl |
amplify,carried |
R2692 |
T4520 |
T4521 |
det |
the,gene |
R2693 |
T4521 |
T4519 |
dobj |
gene,amplify |
R2694 |
T4522 |
T4521 |
amod |
specific,gene |
R2695 |
T4523 |
T4521 |
compound |
mouse,gene |
R2696 |
T4524 |
T4521 |
prep |
from,gene |
R2697 |
T4525 |
T4526 |
det |
the,products |
R2698 |
T4526 |
T4524 |
pobj |
products,from |
R2699 |
T4527 |
T4528 |
amod |
first,round |
R2700 |
T4528 |
T4526 |
compound |
round,products |
R2701 |
T4529 |
T4526 |
compound |
PCR,products |
R2702 |
T4530 |
T4519 |
prep |
at,amplify |
R2703 |
T4531 |
T4532 |
amod |
high,temperature |
R2704 |
T4532 |
T4530 |
pobj |
temperature,at |
R2705 |
T4533 |
T4532 |
amod |
annealing,temperature |
R2706 |
T4534 |
T4532 |
punct |
(,temperature |
R2707 |
T4535 |
T4536 |
nummod |
62,°C |
R2708 |
T4536 |
T4532 |
appos |
°C,temperature |
R2709 |
T4537 |
T4498 |
punct |
),carried |
R2710 |
T4538 |
T4498 |
punct |
.,carried |
R2711 |
T4540 |
T4541 |
det |
The,products |
R2712 |
T4541 |
T4544 |
nsubjpass |
products,excised |
R2713 |
T4542 |
T4541 |
amod |
expected,products |
R2714 |
T4543 |
T4541 |
compound |
PCR,products |
R2715 |
T4545 |
T4544 |
auxpass |
were,excised |
R2716 |
T4546 |
T4544 |
advmod |
directly,excised |
R2717 |
T4547 |
T4544 |
prep |
from,excised |
R2718 |
T4548 |
T4549 |
compound |
agarose,gel |
R2719 |
T4549 |
T4547 |
pobj |
gel,from |
R2720 |
T4550 |
T4544 |
cc |
and,excised |
R2721 |
T4551 |
T4544 |
conj |
sequenced,excised |
R2722 |
T4552 |
T4551 |
prep |
by,sequenced |
R2723 |
T4553 |
T4554 |
det |
an,sequencer |
R2724 |
T4554 |
T4552 |
pobj |
sequencer,by |
R2725 |
T4555 |
T4554 |
nmod |
ABI377,sequencer |
R2726 |
T4556 |
T4554 |
amod |
automatic,sequencer |
R2727 |
T4557 |
T4544 |
punct |
.,excised |
R2728 |
T4559 |
T4560 |
det |
The,sequence |
R2729 |
T4560 |
T4561 |
nsubjpass |
sequence,confirmed |
R2730 |
T4562 |
T4561 |
auxpass |
was,confirmed |
R2731 |
T4563 |
T4561 |
advmod |
further,confirmed |
R2732 |
T4564 |
T4561 |
advcl |
using,confirmed |
R2733 |
T4565 |
T4566 |
det |
a,primer |
R2734 |
T4566 |
T4564 |
dobj |
primer,using |
R2735 |
T4567 |
T4566 |
amod |
forward,primer |
R2736 |
T4568 |
T4566 |
prep |
from,primer |
R2737 |
T4569 |
T4570 |
advmod |
newly,identified |
R2738 |
T4570 |
T4571 |
amod |
identified,sequence |
R2739 |
T4571 |
T4568 |
pobj |
sequence,from |
R2740 |
T4572 |
T4566 |
cc |
and,primer |
R2741 |
T4573 |
T4574 |
det |
a,primer |
R2742 |
T4574 |
T4566 |
conj |
primer,primer |
R2743 |
T4575 |
T4574 |
amod |
reverse,primer |
R2744 |
T4576 |
T4574 |
prep |
from,primer |
R2745 |
T4577 |
T4578 |
amod |
known,sequence |
R2746 |
T4578 |
T4576 |
pobj |
sequence,from |
R2747 |
T4579 |
T4561 |
punct |
.,confirmed |
R2748 |
T4581 |
T4582 |
mark |
Once,identified |
R2749 |
T4582 |
T4589 |
advcl |
identified,obtained |
R2750 |
T4583 |
T4582 |
nsubjpass |
most,identified |
R2751 |
T4584 |
T4583 |
prep |
of,most |
R2752 |
T4585 |
T4586 |
det |
the,sequences |
R2753 |
T4586 |
T4584 |
pobj |
sequences,of |
R2754 |
T4587 |
T4586 |
amod |
coding,sequences |
R2755 |
T4588 |
T4582 |
auxpass |
were,identified |
R2756 |
T4590 |
T4589 |
punct |
", ",obtained |
R2757 |
T4591 |
T4592 |
amod |
partial,sequence |
R2758 |
T4592 |
T4589 |
nsubjpass |
sequence,obtained |
R2759 |
T4593 |
T4592 |
prep |
of,sequence |
R2760 |
T4594 |
T4595 |
nmod |
exon,sequences |
R2761 |
T4595 |
T4593 |
pobj |
sequences,of |
R2762 |
T4596 |
T4594 |
nummod |
1,exon |
R2763 |
T4597 |
T4594 |
cc |
and,exon |
R2764 |
T4598 |
T4599 |
det |
the,UTR |
R2765 |
T4599 |
T4594 |
conj |
UTR,exon |
R2766 |
T4600 |
T4599 |
nummod |
5,UTR |
R2767 |
T4601 |
T4600 |
punct |
',5 |
R2768 |
T4602 |
T4589 |
auxpass |
were,obtained |
R2769 |
T4603 |
T4589 |
prep |
by,obtained |
R2770 |
T4604 |
T4605 |
compound |
BAC,sequencing |
R2771 |
T4605 |
T4603 |
pobj |
sequencing,by |
R2772 |
T4606 |
T4605 |
compound |
DNA,sequencing |
R2773 |
T4607 |
T4589 |
punct |
.,obtained |
R2774 |
T4647 |
T4648 |
compound |
Northern,blot |
R2775 |
T4648 |
T4649 |
compound |
blot,analyses |
R2776 |
T4651 |
T4652 |
amod |
Multiple,filters |
R2777 |
T4652 |
T4656 |
nsubjpass |
filters,purchased |
R2778 |
T4653 |
T4652 |
compound |
Choice,filters |
R2779 |
T4654 |
T4655 |
compound |
Northern,Blot |
R2780 |
T4655 |
T4652 |
compound |
Blot,filters |
R2781 |
T4657 |
T4652 |
acl |
containing,filters |
R2782 |
T4658 |
T4659 |
nummod |
12,tissues |
R2783 |
T4659 |
T4657 |
dobj |
tissues,containing |
R2784 |
T4660 |
T4659 |
amod |
different,tissues |
R2785 |
T4661 |
T4659 |
compound |
mouse,tissues |
R2786 |
T4662 |
T4656 |
auxpass |
were,purchased |
R2787 |
T4663 |
T4656 |
prep |
from,purchased |
R2788 |
T4664 |
T4663 |
pobj |
Origene,from |
R2789 |
T4665 |
T4656 |
punct |
.,purchased |
R2790 |
T4667 |
T4668 |
det |
The,filters |
R2791 |
T4668 |
T4669 |
nsubjpass |
filters,probed |
R2792 |
T4670 |
T4669 |
auxpass |
were,probed |
R2793 |
T4671 |
T4669 |
prep |
for,probed |
R2794 |
T4672 |
T4673 |
det |
each,gene |
R2795 |
T4673 |
T4671 |
pobj |
gene,for |
R2796 |
T4674 |
T4673 |
compound |
Acdp,gene |
R2797 |
T4675 |
T4669 |
prep |
with,probed |
R2798 |
T4676 |
T4677 |
det |
a,fragment |
R2799 |
T4677 |
T4675 |
pobj |
fragment,with |
R2800 |
T4678 |
T4677 |
compound |
PCR,fragment |
R2801 |
T4679 |
T4680 |
punct |
(,bp |
R2802 |
T4680 |
T4677 |
parataxis |
bp,fragment |
R2803 |
T4681 |
T4682 |
quantmod |
around,350 |
R2804 |
T4682 |
T4680 |
nummod |
350,bp |
R2805 |
T4683 |
T4680 |
punct |
),bp |
R2806 |
T4684 |
T4677 |
prep |
from,fragment |
R2807 |
T4685 |
T4686 |
amod |
last,exon |
R2808 |
T4686 |
T4684 |
pobj |
exon,from |
R2809 |
T4687 |
T4669 |
cc |
and,probed |
R2810 |
T4688 |
T4689 |
det |
the,3 |
R2811 |
T4689 |
T4690 |
nummod |
3,region |
R2812 |
T4690 |
T4693 |
nsubj |
region,labeled |
R2813 |
T4691 |
T4689 |
punct |
',3 |
R2814 |
T4692 |
T4689 |
amod |
untranslated,3 |
R2815 |
T4693 |
T4669 |
conj |
labeled,probed |
R2816 |
T4694 |
T4693 |
prep |
with,labeled |
R2817 |
T4695 |
T4696 |
compound |
α,32P |
R2818 |
T4696 |
T4698 |
compound |
32P,dCTP |
R2819 |
T4697 |
T4696 |
punct |
-,32P |
R2820 |
T4698 |
T4694 |
pobj |
dCTP,with |
R2821 |
T4699 |
T4693 |
advcl |
using,labeled |
R2822 |
T4700 |
T4701 |
det |
the,system |
R2823 |
T4701 |
T4699 |
dobj |
system,using |
R2824 |
T4702 |
T4701 |
amod |
random,system |
R2825 |
T4703 |
T4701 |
compound |
primer,system |
R2826 |
T4704 |
T4701 |
compound |
extension,system |
R2827 |
T4705 |
T4706 |
punct |
(,Technologies |
R2828 |
T4706 |
T4701 |
parataxis |
Technologies,system |
R2829 |
T4707 |
T4706 |
compound |
Life,Technologies |
R2830 |
T4708 |
T4706 |
punct |
),Technologies |
R2831 |
T4709 |
T4693 |
punct |
.,labeled |
R2832 |
T4711 |
T4712 |
nsubjpass |
Hybridizations,carried |
R2833 |
T4713 |
T4712 |
auxpass |
were,carried |
R2834 |
T4714 |
T4712 |
prt |
out,carried |
R2835 |
T4715 |
T4712 |
advmod |
overnight,carried |
R2836 |
T4716 |
T4712 |
punct |
.,carried |
R2837 |
T4718 |
T4719 |
det |
The,filters |
R2838 |
T4719 |
T4720 |
nsubjpass |
filters,washed |
R2839 |
T4721 |
T4720 |
auxpass |
were,washed |
R2840 |
T4722 |
T4720 |
advmod |
twice,washed |
R2841 |
T4723 |
T4720 |
prep |
with,washed |
R2842 |
T4724 |
T4725 |
amod |
washing,buffer |
R2843 |
T4725 |
T4723 |
pobj |
buffer,with |
R2844 |
T4726 |
T4725 |
nummod |
I,buffer |
R2845 |
T4727 |
T4728 |
punct |
(,SDS |
R2846 |
T4728 |
T4725 |
parataxis |
SDS,buffer |
R2847 |
T4729 |
T4730 |
nummod |
2,SSC |
R2848 |
T4730 |
T4728 |
dep |
SSC,SDS |
R2849 |
T4731 |
T4730 |
punct |
×,SSC |
R2850 |
T4732 |
T4728 |
punct |
", ",SDS |
R2851 |
T4733 |
T4734 |
nummod |
0.1,% |
R2852 |
T4734 |
T4728 |
compound |
%,SDS |
R2853 |
T4735 |
T4728 |
punct |
),SDS |
R2854 |
T4736 |
T4720 |
prep |
at,washed |
R2855 |
T4737 |
T4738 |
nummod |
42,°C |
R2856 |
T4738 |
T4736 |
pobj |
°C,at |
R2857 |
T4739 |
T4720 |
prep |
for,washed |
R2858 |
T4740 |
T4741 |
nummod |
15,min |
R2859 |
T4741 |
T4739 |
pobj |
min,for |
R2860 |
T4742 |
T4741 |
punct |
-,min |
R2861 |
T4743 |
T4720 |
punct |
", ",washed |
R2862 |
T4744 |
T4720 |
cc |
and,washed |
R2863 |
T4745 |
T4746 |
advmod |
then,washed |
R2864 |
T4746 |
T4720 |
conj |
washed,washed |
R2865 |
T4747 |
T4746 |
advmod |
twice,washed |
R2866 |
T4748 |
T4746 |
prep |
with,washed |
R2867 |
T4749 |
T4750 |
compound |
washing,buffer |
R2868 |
T4750 |
T4748 |
pobj |
buffer,with |
R2869 |
T4751 |
T4750 |
nummod |
II,buffer |
R2870 |
T4752 |
T4753 |
punct |
(,SDS |
R2871 |
T4753 |
T4750 |
parataxis |
SDS,buffer |
R2872 |
T4754 |
T4755 |
nummod |
0.25,SSC |
R2873 |
T4755 |
T4753 |
dep |
SSC,SDS |
R2874 |
T4756 |
T4755 |
punct |
×,SSC |
R2875 |
T4757 |
T4753 |
punct |
", ",SDS |
R2876 |
T4758 |
T4759 |
nummod |
0.1,% |
R2877 |
T4759 |
T4753 |
compound |
%,SDS |
R2878 |
T4760 |
T4753 |
punct |
),SDS |
R2879 |
T4761 |
T4746 |
prep |
at,washed |
R288 |
T593 |
T594 |
nsubj |
We,cloned |
R2880 |
T4762 |
T4763 |
nummod |
65,°C |
R2881 |
T4763 |
T4761 |
pobj |
°C,at |
R2882 |
T4764 |
T4746 |
prep |
for,washed |
R2883 |
T4765 |
T4766 |
nummod |
15,min |
R2884 |
T4766 |
T4764 |
pobj |
min,for |
R2885 |
T4767 |
T4766 |
punct |
-,min |
R2886 |
T4768 |
T4720 |
punct |
.,washed |
R2887 |
T4770 |
T4771 |
amod |
Washed,filters |
R2888 |
T4771 |
T4772 |
nsubjpass |
filters,exposed |
R2889 |
T4773 |
T4772 |
auxpass |
were,exposed |
R289 |
T595 |
T594 |
aux |
have,cloned |
R2890 |
T4774 |
T4772 |
prep |
to,exposed |
R2891 |
T4775 |
T4776 |
compound |
X-ray,films |
R2892 |
T4776 |
T4774 |
pobj |
films,to |
R2893 |
T4777 |
T4772 |
prep |
for,exposed |
R2894 |
T4778 |
T4777 |
pcomp |
overnight,for |
R2895 |
T4779 |
T4778 |
cc |
or,overnight |
R2896 |
T4780 |
T4778 |
conj |
longer,overnight |
R2897 |
T4781 |
T4782 |
punct |
[,4 |
R2898 |
T4782 |
T4772 |
parataxis |
4,exposed |
R2899 |
T4783 |
T4782 |
nummod |
3,4 |
R290 |
T596 |
T594 |
advmod |
recently,cloned |
R2900 |
T4784 |
T4782 |
punct |
",",4 |
R2901 |
T4785 |
T4782 |
punct |
],4 |
R2902 |
T4786 |
T4772 |
punct |
.,exposed |
R2904 |
T4823 |
T4824 |
compound |
Antibody,production |
R2905 |
T4825 |
T4824 |
cc |
and,production |
R2906 |
T4826 |
T4827 |
compound |
Western,blot |
R2907 |
T4827 |
T4828 |
compound |
blot,analyses |
R2908 |
T4828 |
T4824 |
conj |
analyses,production |
R2909 |
T4830 |
T4831 |
nsubjpass |
Peptides,used |
R291 |
T597 |
T594 |
cc |
and,cloned |
R2910 |
T4832 |
T4830 |
acl |
linked,Peptides |
R2911 |
T4833 |
T4832 |
prep |
to,linked |
R2912 |
T4834 |
T4833 |
pobj |
KLH,to |
R2913 |
T4835 |
T4834 |
punct |
(,KLH |
R2914 |
T4836 |
T4837 |
compound |
keyhole,hemacyanin |
R2915 |
T4837 |
T4834 |
appos |
hemacyanin,KLH |
R2916 |
T4838 |
T4837 |
compound |
limpet,hemacyanin |
R2917 |
T4839 |
T4833 |
punct |
),to |
R2918 |
T4840 |
T4833 |
prep |
from,to |
R2919 |
T4841 |
T4842 |
nmod |
Acdp1,terminals |
R292 |
T598 |
T594 |
conj |
characterized,cloned |
R2920 |
T4842 |
T4840 |
pobj |
terminals,from |
R2921 |
T4843 |
T4842 |
nmod |
N,terminals |
R2922 |
T4844 |
T4843 |
punct |
-,N |
R2923 |
T4845 |
T4843 |
cc |
and,N |
R2924 |
T4846 |
T4843 |
conj |
C,N |
R2925 |
T4847 |
T4842 |
punct |
-,terminals |
R2926 |
T4848 |
T4842 |
cc |
and,terminals |
R2927 |
T4849 |
T4850 |
det |
the,domain |
R2928 |
T4850 |
T4842 |
conj |
domain,terminals |
R2929 |
T4851 |
T4850 |
amod |
conserved,domain |
R293 |
T599 |
T600 |
det |
a,family |
R2930 |
T4852 |
T4850 |
punct |
(,domain |
R2931 |
T4853 |
T4850 |
appos |
ACD,domain |
R2932 |
T4854 |
T4831 |
punct |
),used |
R2933 |
T4855 |
T4831 |
auxpass |
were,used |
R2934 |
T4856 |
T4831 |
prep |
for,used |
R2935 |
T4857 |
T4856 |
pobj |
generation,for |
R2936 |
T4858 |
T4857 |
prep |
of,generation |
R2937 |
T4859 |
T4858 |
pobj |
antibodies,of |
R2938 |
T4860 |
T4861 |
advmod |
specifically,for |
R2939 |
T4861 |
T4856 |
prep |
for,for |
R294 |
T600 |
T598 |
dobj |
family,characterized |
R2940 |
T4862 |
T4861 |
pobj |
Acdp1,for |
R2941 |
T4863 |
T4862 |
cc |
and,Acdp1 |
R2942 |
T4864 |
T4865 |
det |
all,members |
R2943 |
T4865 |
T4862 |
conj |
members,Acdp1 |
R2944 |
T4866 |
T4865 |
compound |
Acdp,members |
R2945 |
T4867 |
T4868 |
mark |
as,reported |
R2946 |
T4868 |
T4831 |
advcl |
reported,used |
R2947 |
T4869 |
T4831 |
punct |
", ",used |
R2948 |
T4870 |
T4831 |
advmod |
respectively,used |
R2949 |
T4871 |
T4872 |
punct |
[,5 |
R295 |
T601 |
T600 |
amod |
novel,family |
R2950 |
T4872 |
T4831 |
parataxis |
5,used |
R2951 |
T4873 |
T4872 |
punct |
],5 |
R2952 |
T4874 |
T4831 |
punct |
.,used |
R2953 |
T4876 |
T4877 |
compound |
Western,blots |
R2954 |
T4877 |
T4878 |
nsubjpass |
blots,carried |
R2955 |
T4879 |
T4878 |
auxpass |
were,carried |
R2956 |
T4880 |
T4878 |
prt |
out,carried |
R2957 |
T4881 |
T4878 |
advcl |
Using,carried |
R2958 |
T4882 |
T4881 |
dobj |
ECL,Using |
R2959 |
T4883 |
T4884 |
punct |
(,PIERCE |
R296 |
T602 |
T600 |
compound |
gene,family |
R2960 |
T4884 |
T4882 |
parataxis |
PIERCE,ECL |
R2961 |
T4885 |
T4884 |
punct |
),PIERCE |
R2962 |
T4886 |
T4887 |
mark |
as,described |
R2963 |
T4887 |
T4878 |
advcl |
described,carried |
R2964 |
T4888 |
T4887 |
advmod |
previously,described |
R2965 |
T4889 |
T4890 |
punct |
[,1 |
R2966 |
T4890 |
T4878 |
parataxis |
1,carried |
R2967 |
T4891 |
T4890 |
punct |
],1 |
R2968 |
T4892 |
T4878 |
punct |
.,carried |
R2969 |
T4894 |
T4895 |
det |
The,membranes |
R297 |
T603 |
T600 |
acl |
named,family |
R2970 |
T4895 |
T4896 |
nsubjpass |
membranes,washed |
R2971 |
T4897 |
T4896 |
auxpass |
were,washed |
R2972 |
T4898 |
T4896 |
advmod |
extensively,washed |
R2973 |
T4899 |
T4896 |
prep |
after,washed |
R2974 |
T4900 |
T4899 |
pobj |
incubation,after |
R2975 |
T4901 |
T4900 |
prep |
with,incubation |
R2976 |
T4902 |
T4903 |
amod |
primary,antibodies |
R2977 |
T4903 |
T4901 |
pobj |
antibodies,with |
R2978 |
T4904 |
T4902 |
cc |
and,primary |
R2979 |
T4905 |
T4902 |
conj |
secondary,primary |
R298 |
T604 |
T605 |
amod |
ancient,protein |
R2980 |
T4906 |
T4896 |
cc |
and,washed |
R2981 |
T4907 |
T4908 |
auxpass |
were,developed |
R2982 |
T4908 |
T4896 |
conj |
developed,washed |
R2983 |
T4909 |
T4908 |
advmod |
then,developed |
R2984 |
T4910 |
T4908 |
prep |
with,developed |
R2985 |
T4911 |
T4912 |
compound |
X-ray,films |
R2986 |
T4912 |
T4910 |
pobj |
films,with |
R2987 |
T4913 |
T4912 |
prep |
with,films |
R2988 |
T4914 |
T4915 |
amod |
optimal,time |
R2989 |
T4915 |
T4913 |
pobj |
time,with |
R299 |
T605 |
T603 |
oprd |
protein,named |
R2990 |
T4916 |
T4915 |
compound |
exposure,time |
R2991 |
T4917 |
T4896 |
punct |
.,washed |
R2992 |
T4941 |
T4942 |
compound |
Chromosome,localization |
R2993 |
T4944 |
T4945 |
det |
The,panel |
R2994 |
T4945 |
T4950 |
nsubjpass |
panel,used |
R2995 |
T4946 |
T4945 |
compound |
T31,panel |
R2996 |
T4947 |
T4945 |
compound |
mouse,panel |
R2997 |
T4948 |
T4945 |
compound |
radiation,panel |
R2998 |
T4949 |
T4945 |
compound |
hybrid,panel |
R2999 |
T4951 |
T4945 |
prep |
from,panel |
R300 |
T606 |
T605 |
amod |
conserved,protein |
R3000 |
T4952 |
T4953 |
compound |
Research,Genetics |
R3001 |
T4953 |
T4951 |
pobj |
Genetics,from |
R3002 |
T4954 |
T4950 |
auxpass |
was,used |
R3003 |
T4955 |
T4956 |
aux |
to,map |
R3004 |
T4956 |
T4950 |
advcl |
map,used |
R3005 |
T4957 |
T4958 |
det |
the,location |
R3006 |
T4958 |
T4956 |
dobj |
location,map |
R3007 |
T4959 |
T4958 |
compound |
chromosome,location |
R3008 |
T4960 |
T4958 |
prep |
of,location |
R3009 |
T4961 |
T4962 |
det |
each,member |
R301 |
T607 |
T605 |
compound |
domain,protein |
R3010 |
T4962 |
T4960 |
pobj |
member,of |
R3011 |
T4963 |
T4962 |
compound |
Acdp,member |
R3012 |
T4964 |
T4950 |
punct |
.,used |
R3013 |
T4966 |
T4967 |
nsubjpass |
Primers,used |
R3014 |
T4968 |
T4966 |
prep |
from,Primers |
R3015 |
T4969 |
T4970 |
nummod |
3,UTR |
R3016 |
T4970 |
T4968 |
pobj |
UTR,from |
R3017 |
T4971 |
T4969 |
punct |
',3 |
R3018 |
T4972 |
T4970 |
prep |
of,UTR |
R3019 |
T4973 |
T4974 |
det |
each,member |
R302 |
T608 |
T605 |
punct |
(,protein |
R3020 |
T4974 |
T4972 |
pobj |
member,of |
R3021 |
T4975 |
T4974 |
compound |
Acdp,member |
R3022 |
T4976 |
T4967 |
auxpass |
were,used |
R3023 |
T4977 |
T4978 |
aux |
to,amplify |
R3024 |
T4978 |
T4967 |
advcl |
amplify,used |
R3025 |
T4979 |
T4980 |
det |
the,clones |
R3026 |
T4980 |
T4978 |
dobj |
clones,amplify |
R3027 |
T4981 |
T4980 |
nummod |
100,clones |
R3028 |
T4982 |
T4980 |
nmod |
radiation,clones |
R3029 |
T4983 |
T4980 |
amod |
hybrid,clones |
R303 |
T609 |
T605 |
appos |
ACDP,protein |
R3030 |
T4984 |
T4980 |
acl |
representing,clones |
R3031 |
T4985 |
T4986 |
det |
the,genome |
R3032 |
T4986 |
T4984 |
dobj |
genome,representing |
R3033 |
T4987 |
T4986 |
compound |
mouse,genome |
R3034 |
T4988 |
T4967 |
punct |
.,used |
R3035 |
T4990 |
T4991 |
det |
The,data |
R3036 |
T4991 |
T4992 |
nsubjpass |
data,submitted |
R3037 |
T4993 |
T4992 |
auxpass |
were,submitted |
R3038 |
T4994 |
T4992 |
prep |
to,submitted |
R3039 |
T4995 |
T4996 |
det |
the,Database |
R304 |
T610 |
T605 |
punct |
),protein |
R3040 |
T4996 |
T4994 |
pobj |
Database,to |
R3041 |
T4997 |
T4998 |
compound |
Jackson,Laboratory |
R3042 |
T4998 |
T4996 |
compound |
Laboratory,Database |
R3043 |
T4999 |
T5000 |
compound |
Mouse,Hybrid |
R3044 |
T5000 |
T4996 |
compound |
Hybrid,Database |
R3045 |
T5001 |
T5000 |
compound |
Radiation,Hybrid |
R3046 |
T5002 |
T4992 |
prep |
for,submitted |
R3047 |
T5003 |
T5002 |
pobj |
analysis,for |
R3048 |
T5004 |
T4992 |
punct |
.,submitted |
R3049 |
T5023 |
T5024 |
compound |
Sequence,analyses |
R305 |
T611 |
T612 |
dep |
which,encodes |
R3050 |
T5026 |
T5027 |
compound |
Sequence,assembly |
R3051 |
T5027 |
T5028 |
nsubjpass |
assembly,performed |
R3052 |
T5029 |
T5028 |
auxpass |
was,performed |
R3053 |
T5030 |
T5028 |
prep |
with,performed |
R3054 |
T5031 |
T5032 |
compound |
program,Sequencher |
R3055 |
T5032 |
T5030 |
pobj |
Sequencher,with |
R3056 |
T5033 |
T5034 |
punct |
(,Corp |
R3057 |
T5034 |
T5032 |
parataxis |
Corp,Sequencher |
R3058 |
T5035 |
T5034 |
compound |
Gene,Corp |
R3059 |
T5036 |
T5034 |
compound |
Codes,Corp |
R306 |
T612 |
T600 |
relcl |
encodes,family |
R3060 |
T5037 |
T5034 |
punct |
),Corp |
R3061 |
T5038 |
T5028 |
punct |
.,performed |
R3062 |
T5040 |
T5041 |
nmod |
Protein,homology |
R3063 |
T5041 |
T5044 |
compound |
homology,searches |
R3064 |
T5042 |
T5040 |
cc |
and,Protein |
R3065 |
T5043 |
T5040 |
conj |
DNA,Protein |
R3066 |
T5044 |
T5045 |
nsubjpass |
searches,carried |
R3067 |
T5046 |
T5045 |
auxpass |
were,carried |
R3068 |
T5047 |
T5045 |
prt |
out,carried |
R3069 |
T5048 |
T5045 |
prep |
with,carried |
R307 |
T613 |
T614 |
nummod |
four,members |
R3070 |
T5049 |
T5050 |
nmod |
tblastn,programs |
R3071 |
T5050 |
T5048 |
pobj |
programs,with |
R3072 |
T5051 |
T5049 |
punct |
", ",tblastn |
R3073 |
T5052 |
T5049 |
conj |
tblastx,tblastn |
R3074 |
T5053 |
T5052 |
punct |
", ",tblastx |
R3075 |
T5054 |
T5052 |
conj |
blastp,tblastx |
R3076 |
T5055 |
T5054 |
cc |
and,blastp |
R3077 |
T5056 |
T5054 |
conj |
blastn,blastp |
R3078 |
T5057 |
T5045 |
punct |
.,carried |
R3079 |
T5059 |
T5060 |
amod |
Multiple,alignments |
R308 |
T614 |
T612 |
dobj |
members,encodes |
R3080 |
T5060 |
T5062 |
nsubjpass |
alignments,performed |
R3081 |
T5061 |
T5060 |
compound |
sequence,alignments |
R3082 |
T5063 |
T5062 |
auxpass |
were,performed |
R3083 |
T5064 |
T5062 |
prep |
with,performed |
R3084 |
T5065 |
T5066 |
nmod |
GeneDoc,alignment |
R3085 |
T5066 |
T5064 |
pobj |
alignment,with |
R3086 |
T5067 |
T5065 |
cc |
and,GeneDoc |
R3087 |
T5068 |
T5065 |
conj |
pairwise,GeneDoc |
R3088 |
T5069 |
T5066 |
compound |
sequence,alignment |
R3089 |
T5070 |
T5062 |
punct |
.,performed |
R309 |
T615 |
T614 |
compound |
protein,members |
R3090 |
T5072 |
T5073 |
amod |
Multiple,programs |
R3091 |
T5073 |
T5074 |
nsubjpass |
programs,used |
R3092 |
T5075 |
T5073 |
prep |
including,programs |
R3093 |
T5076 |
T5077 |
compound |
BCM,Launcher |
R3094 |
T5077 |
T5075 |
pobj |
Launcher,including |
R3095 |
T5078 |
T5077 |
compound |
Search,Launcher |
R3096 |
T5079 |
T5077 |
punct |
", ",Launcher |
R3097 |
T5080 |
T5077 |
conj |
ProfileScan,Launcher |
R3098 |
T5081 |
T5080 |
punct |
", ",ProfileScan |
R3099 |
T5082 |
T5083 |
compound |
sequence,search |
R310 |
T616 |
T612 |
prep |
in,encodes |
R3100 |
T5083 |
T5080 |
conj |
search,ProfileScan |
R3101 |
T5084 |
T5083 |
compound |
motif,search |
R3102 |
T5085 |
T5083 |
punct |
", ",search |
R3103 |
T5086 |
T5083 |
conj |
ExPASy,search |
R3104 |
T5087 |
T5086 |
cc |
and,ExPASy |
R3105 |
T5088 |
T5086 |
conj |
3Dpssm,ExPASy |
R3106 |
T5089 |
T5074 |
auxpass |
were,used |
R3107 |
T5090 |
T5074 |
prep |
for,used |
R3108 |
T5091 |
T5090 |
pcomp |
searching,for |
R3109 |
T5092 |
T5093 |
compound |
sequence,features |
R311 |
T617 |
T616 |
pobj |
humans,in |
R3110 |
T5093 |
T5091 |
dobj |
features,searching |
R3111 |
T5094 |
T5093 |
prep |
of,features |
R3112 |
T5095 |
T5096 |
amod |
known,protein |
R3113 |
T5096 |
T5094 |
pobj |
protein,of |
R3114 |
T5097 |
T5074 |
punct |
.,used |
R3115 |
T5099 |
T5100 |
amod |
Phylogenetic,tree |
R3116 |
T5100 |
T5101 |
nsubjpass |
tree,constructed |
R3117 |
T5102 |
T5101 |
auxpass |
was,constructed |
R3118 |
T5103 |
T5101 |
agent |
by,constructed |
R3119 |
T5104 |
T5105 |
compound |
Clustalw,program |
R312 |
T618 |
T619 |
punct |
[,1 |
R3120 |
T5105 |
T5103 |
pobj |
program,by |
R3121 |
T5106 |
T5107 |
punct |
(,version |
R3122 |
T5107 |
T5105 |
parataxis |
version,program |
R3123 |
T5108 |
T5107 |
nummod |
1.81,version |
R3124 |
T5109 |
T5107 |
punct |
),version |
R3125 |
T5110 |
T5101 |
advcl |
using,constructed |
R3126 |
T5111 |
T5112 |
nmod |
UPGMA,algorithm |
R3127 |
T5112 |
T5110 |
dobj |
algorithm,using |
R3128 |
T5113 |
T5111 |
punct |
(,UPGMA |
R3129 |
T5114 |
T5115 |
amod |
Unweighted,Method |
R313 |
T619 |
T598 |
parataxis |
1,characterized |
R3130 |
T5115 |
T5111 |
appos |
Method,UPGMA |
R3131 |
T5116 |
T5115 |
compound |
Pair,Method |
R3132 |
T5117 |
T5115 |
compound |
Group,Method |
R3133 |
T5118 |
T5115 |
acl |
using,Method |
R3134 |
T5119 |
T5120 |
compound |
Arithmetic,averages |
R3135 |
T5120 |
T5118 |
dobj |
averages,using |
R3136 |
T5121 |
T5112 |
punct |
),algorithm |
R3137 |
T5122 |
T5123 |
punct |
[,14 |
R3138 |
T5123 |
T5101 |
parataxis |
14,constructed |
R3139 |
T5124 |
T5123 |
punct |
],14 |
R314 |
T620 |
T619 |
punct |
],1 |
R3140 |
T5125 |
T5101 |
punct |
.,constructed |
R3141 |
T5264 |
T5265 |
amod |
Neuronal,preparation |
R3142 |
T5266 |
T5265 |
compound |
cell,preparation |
R3143 |
T5267 |
T5265 |
cc |
and,preparation |
R3144 |
T5268 |
T5265 |
conj |
immunostanining,preparation |
R3145 |
T5270 |
T5271 |
amod |
Hippocampal,cultures |
R3146 |
T5271 |
T5273 |
nsubjpass |
cultures,prepared |
R3147 |
T5272 |
T5271 |
compound |
neuron,cultures |
R3148 |
T5274 |
T5273 |
auxpass |
were,prepared |
R3149 |
T5275 |
T5276 |
mark |
as,reported |
R315 |
T621 |
T594 |
punct |
.,cloned |
R3150 |
T5276 |
T5273 |
advcl |
reported,prepared |
R3151 |
T5277 |
T5276 |
advmod |
previously,reported |
R3152 |
T5278 |
T5279 |
punct |
[,6 |
R3153 |
T5279 |
T5273 |
parataxis |
6,prepared |
R3154 |
T5280 |
T5279 |
punct |
],6 |
R3155 |
T5281 |
T5273 |
punct |
.,prepared |
R3156 |
T5283 |
T5284 |
prep |
In,dissected |
R3157 |
T5285 |
T5283 |
pobj |
brief,In |
R3158 |
T5286 |
T5284 |
punct |
", ",dissected |
R3159 |
T5287 |
T5288 |
det |
the,hippocampuses |
R316 |
T623 |
T624 |
nsubj |
We,found |
R3160 |
T5288 |
T5284 |
nsubjpass |
hippocampuses,dissected |
R3161 |
T5289 |
T5284 |
auxpass |
were,dissected |
R3162 |
T5290 |
T5284 |
prt |
out,dissected |
R3163 |
T5291 |
T5284 |
prep |
from,dissected |
R3164 |
T5292 |
T5293 |
compound |
mouse,embryos |
R3165 |
T5293 |
T5291 |
pobj |
embryos,from |
R3166 |
T5294 |
T5284 |
prep |
at,dissected |
R3167 |
T5295 |
T5296 |
nummod |
16,days |
R3168 |
T5296 |
T5294 |
pobj |
days,at |
R3169 |
T5297 |
T5298 |
advmod |
in,utero |
R317 |
T625 |
T626 |
mark |
that,is |
R3170 |
T5298 |
T5296 |
advmod |
utero,days |
R3171 |
T5299 |
T5284 |
punct |
.,dissected |
R3172 |
T5301 |
T5302 |
det |
The,tissues |
R3173 |
T5302 |
T5303 |
nsubjpass |
tissues,incubated |
R3174 |
T5304 |
T5303 |
auxpass |
were,incubated |
R3175 |
T5305 |
T5303 |
advmod |
then,incubated |
R3176 |
T5306 |
T5303 |
prep |
for,incubated |
R3177 |
T5307 |
T5308 |
nummod |
20,min |
R3178 |
T5308 |
T5306 |
pobj |
min,for |
R3179 |
T5309 |
T5303 |
prep |
at,incubated |
R318 |
T626 |
T624 |
ccomp |
is,found |
R3180 |
T5310 |
T5311 |
nummod |
37,°C |
R3181 |
T5311 |
T5309 |
pobj |
°C,at |
R3182 |
T5312 |
T5303 |
prep |
in,incubated |
R3183 |
T5313 |
T5312 |
pobj |
MEM,in |
R3184 |
T5314 |
T5313 |
punct |
(,MEM |
R3185 |
T5315 |
T5316 |
amod |
minimum,medium |
R3186 |
T5316 |
T5313 |
appos |
medium,MEM |
R3187 |
T5317 |
T5316 |
amod |
essential,medium |
R3188 |
T5318 |
T5313 |
punct |
),MEM |
R3189 |
T5319 |
T5313 |
acl |
modified,MEM |
R319 |
T627 |
T628 |
det |
this,family |
R3190 |
T5320 |
T5319 |
prep |
for,modified |
R3191 |
T5321 |
T5322 |
compound |
suspension,culture |
R3192 |
T5322 |
T5320 |
pobj |
culture,for |
R3193 |
T5323 |
T5324 |
punct |
(,Technologies |
R3194 |
T5324 |
T5313 |
parataxis |
Technologies,MEM |
R3195 |
T5325 |
T5324 |
compound |
Life,Technologies |
R3196 |
T5326 |
T5324 |
punct |
),Technologies |
R3197 |
T5327 |
T5313 |
cc |
plus,MEM |
R3198 |
T5328 |
T5329 |
nummod |
0.25,% |
R3199 |
T5329 |
T5330 |
compound |
%,trypsin |
R320 |
T628 |
T626 |
nsubj |
family,is |
R3200 |
T5330 |
T5313 |
conj |
trypsin,MEM |
R3201 |
T5331 |
T5332 |
punct |
(,Technologies |
R3202 |
T5332 |
T5330 |
parataxis |
Technologies,trypsin |
R3203 |
T5333 |
T5332 |
compound |
Life,Technologies |
R3204 |
T5334 |
T5332 |
punct |
),Technologies |
R3205 |
T5335 |
T5303 |
punct |
.,incubated |
R3206 |
T5337 |
T5338 |
det |
The,neurons |
R3207 |
T5338 |
T5341 |
nsubjpass |
neurons,plated |
R3208 |
T5339 |
T5338 |
amod |
dissociated,neurons |
R3209 |
T5340 |
T5338 |
amod |
hippocampal,neurons |
R321 |
T629 |
T628 |
compound |
gene,family |
R3210 |
T5342 |
T5341 |
auxpass |
were,plated |
R3211 |
T5343 |
T5341 |
prep |
on,plated |
R3212 |
T5344 |
T5345 |
compound |
glass,coverslips |
R3213 |
T5345 |
T5343 |
pobj |
coverslips,on |
R3214 |
T5346 |
T5345 |
acl |
coated,coverslips |
R3215 |
T5347 |
T5346 |
prep |
with,coated |
R3216 |
T5348 |
T5349 |
det |
a,monolayer |
R3217 |
T5349 |
T5347 |
pobj |
monolayer,with |
R3218 |
T5350 |
T5349 |
amod |
confluent,monolayer |
R3219 |
T5351 |
T5349 |
prep |
of,monolayer |
R322 |
T630 |
T631 |
advmod |
evolutionarily,conserved |
R3220 |
T5352 |
T5353 |
nmod |
mouse,astrocytes |
R3221 |
T5353 |
T5351 |
pobj |
astrocytes,of |
R3222 |
T5354 |
T5353 |
amod |
cortical,astrocytes |
R3223 |
T5355 |
T5353 |
acl |
obtained,astrocytes |
R3224 |
T5356 |
T5357 |
mark |
as,described |
R3225 |
T5357 |
T5355 |
advcl |
described,obtained |
R3226 |
T5358 |
T5357 |
advmod |
below,described |
R3227 |
T5359 |
T5341 |
punct |
.,plated |
R3228 |
T5361 |
T5362 |
det |
The,neurons |
R3229 |
T5362 |
T5363 |
nsubjpass |
neurons,maintained |
R323 |
T631 |
T626 |
acomp |
conserved,is |
R3230 |
T5364 |
T5363 |
auxpass |
were,maintained |
R3231 |
T5365 |
T5363 |
prep |
at,maintained |
R3232 |
T5366 |
T5367 |
nummod |
37,°C |
R3233 |
T5367 |
T5365 |
pobj |
°C,at |
R3234 |
T5368 |
T5363 |
prep |
in,maintained |
R3235 |
T5369 |
T5370 |
det |
a,atmosphere |
R3236 |
T5370 |
T5368 |
pobj |
atmosphere,in |
R3237 |
T5371 |
T5370 |
amod |
humidified,atmosphere |
R3238 |
T5372 |
T5370 |
prep |
with,atmosphere |
R3239 |
T5373 |
T5374 |
nummod |
5,% |
R324 |
T632 |
T626 |
prep |
in,is |
R3240 |
T5374 |
T5375 |
compound |
%,CO2 |
R3241 |
T5375 |
T5372 |
pobj |
CO2,with |
R3242 |
T5376 |
T5363 |
punct |
.,maintained |
R3243 |
T5378 |
T5379 |
amod |
Cortical,astrocytes |
R3244 |
T5379 |
T5380 |
nsubjpass |
astrocytes,grown |
R3245 |
T5381 |
T5379 |
acl |
dissociated,astrocytes |
R3246 |
T5382 |
T5381 |
prep |
from,dissociated |
R3247 |
T5383 |
T5384 |
amod |
newborn,mouse |
R3248 |
T5384 |
T5385 |
compound |
mouse,cortices |
R3249 |
T5385 |
T5382 |
pobj |
cortices,from |
R325 |
T633 |
T634 |
amod |
diverse,species |
R3250 |
T5386 |
T5380 |
auxpass |
were,grown |
R3251 |
T5387 |
T5380 |
prep |
in,grown |
R3252 |
T5388 |
T5389 |
compound |
culture,flasks |
R3253 |
T5389 |
T5387 |
pobj |
flasks,in |
R3254 |
T5390 |
T5380 |
prep |
at,grown |
R3255 |
T5391 |
T5392 |
nummod |
37,°C |
R3256 |
T5392 |
T5390 |
pobj |
°C,at |
R3257 |
T5393 |
T5380 |
prep |
in,grown |
R3258 |
T5394 |
T5395 |
det |
a,atmosphere |
R3259 |
T5395 |
T5393 |
pobj |
atmosphere,in |
R326 |
T634 |
T632 |
pobj |
species,in |
R3260 |
T5396 |
T5395 |
amod |
humidified,atmosphere |
R3261 |
T5397 |
T5395 |
prep |
with,atmosphere |
R3262 |
T5398 |
T5399 |
nummod |
5,% |
R3263 |
T5399 |
T5400 |
compound |
%,CO2 |
R3264 |
T5400 |
T5397 |
pobj |
CO2,with |
R3265 |
T5401 |
T5380 |
prep |
until,grown |
R3266 |
T5402 |
T5401 |
pcomp |
confluent,until |
R3267 |
T5403 |
T5380 |
punct |
.,grown |
R3268 |
T5405 |
T5406 |
det |
The,cells |
R3269 |
T5406 |
T5407 |
nsubjpass |
cells,exposed |
R327 |
T635 |
T634 |
acl |
ranging,species |
R3270 |
T5408 |
T5407 |
auxpass |
were,exposed |
R3271 |
T5409 |
T5407 |
prep |
to,exposed |
R3272 |
T5410 |
T5411 |
quantmod |
10,5 |
R3273 |
T5411 |
T5413 |
nummod |
5,M |
R3274 |
T5412 |
T5411 |
punct |
-,5 |
R3275 |
T5413 |
T5414 |
compound |
M,arabinoside |
R3276 |
T5414 |
T5409 |
pobj |
arabinoside,to |
R3277 |
T5415 |
T5414 |
compound |
cytosine,arabinoside |
R3278 |
T5416 |
T5417 |
punct |
(,Sigma |
R3279 |
T5417 |
T5414 |
parataxis |
Sigma,arabinoside |
R328 |
T636 |
T635 |
prep |
from,ranging |
R3280 |
T5418 |
T5417 |
punct |
),Sigma |
R3281 |
T5419 |
T5407 |
cc |
and,exposed |
R3282 |
T5420 |
T5407 |
conj |
cultured,exposed |
R3283 |
T5421 |
T5420 |
prep |
for,cultured |
R3284 |
T5422 |
T5423 |
amod |
additional,hrs |
R3285 |
T5423 |
T5421 |
pobj |
hrs,for |
R3286 |
T5424 |
T5425 |
quantmod |
12,24 |
R3287 |
T5425 |
T5423 |
nummod |
24,hrs |
R3288 |
T5426 |
T5425 |
punct |
–,24 |
R3289 |
T5427 |
T5420 |
prep |
at,cultured |
R329 |
T637 |
T636 |
pobj |
bacteria,from |
R3290 |
T5428 |
T5429 |
nummod |
37,°C |
R3291 |
T5429 |
T5427 |
pobj |
°C,at |
R3292 |
T5430 |
T5407 |
punct |
.,exposed |
R3293 |
T5432 |
T5433 |
prep |
After,used |
R3294 |
T5434 |
T5432 |
pobj |
remove,After |
R3295 |
T5435 |
T5434 |
prep |
of,remove |
R3296 |
T5436 |
T5437 |
det |
the,media |
R3297 |
T5437 |
T5435 |
pobj |
media,of |
R3298 |
T5438 |
T5434 |
prep |
with,remove |
R3299 |
T5439 |
T5440 |
amod |
cellular,debris |
R330 |
T638 |
T637 |
punct |
", ",bacteria |
R3300 |
T5440 |
T5438 |
pobj |
debris,with |
R3301 |
T5441 |
T5433 |
punct |
", ",used |
R3302 |
T5442 |
T5443 |
det |
the,cells |
R3303 |
T5443 |
T5433 |
nsubjpass |
cells,used |
R3304 |
T5444 |
T5433 |
auxpass |
were,used |
R3305 |
T5445 |
T5433 |
prep |
for,used |
R3306 |
T5446 |
T5445 |
pcomp |
coating,for |
R3307 |
T5447 |
T5446 |
dobj |
coverslips,coating |
R3308 |
T5448 |
T5433 |
punct |
.,used |
R3309 |
T5450 |
T5451 |
prep |
For,fixed |
R331 |
T639 |
T637 |
conj |
yeast,bacteria |
R3310 |
T5452 |
T5450 |
pobj |
immunostaining,For |
R3311 |
T5453 |
T5451 |
punct |
", ",fixed |
R3312 |
T5454 |
T5455 |
amod |
neuronal,cells |
R3313 |
T5455 |
T5451 |
nsubjpass |
cells,fixed |
R3314 |
T5456 |
T5455 |
prep |
on,cells |
R3315 |
T5457 |
T5458 |
det |
the,coverslips |
R3316 |
T5458 |
T5456 |
pobj |
coverslips,on |
R3317 |
T5459 |
T5451 |
auxpass |
were,fixed |
R3318 |
T5460 |
T5451 |
advmod |
first,fixed |
R3319 |
T5461 |
T5451 |
prep |
in,fixed |
R332 |
T640 |
T639 |
punct |
", ",yeast |
R3320 |
T5462 |
T5461 |
pobj |
PBS,in |
R3321 |
T5463 |
T5462 |
acl |
containing,PBS |
R3322 |
T5464 |
T5465 |
nummod |
4,% |
R3323 |
T5465 |
T5466 |
compound |
%,paraformaldehyde |
R3324 |
T5466 |
T5463 |
dobj |
paraformaldehyde,containing |
R3325 |
T5467 |
T5466 |
punct |
(,paraformaldehyde |
R3326 |
T5468 |
T5466 |
appos |
PFA,paraformaldehyde |
R3327 |
T5469 |
T5463 |
punct |
),containing |
R3328 |
T5470 |
T5463 |
prep |
for,containing |
R3329 |
T5471 |
T5472 |
nummod |
12,hrs |
R333 |
T641 |
T642 |
compound |
C.,elegans |
R3330 |
T5472 |
T5470 |
pobj |
hrs,for |
R3331 |
T5473 |
T5463 |
prep |
at,containing |
R3332 |
T5474 |
T5475 |
nummod |
4,°C |
R3333 |
T5475 |
T5473 |
pobj |
°C,at |
R3334 |
T5476 |
T5451 |
cc |
and,fixed |
R3335 |
T5477 |
T5478 |
advmod |
then,incubated |
R3336 |
T5478 |
T5451 |
conj |
incubated,fixed |
R3337 |
T5479 |
T5478 |
prep |
in,incubated |
R3338 |
T5480 |
T5481 |
det |
a,solution |
R3339 |
T5481 |
T5479 |
pobj |
solution,in |
R334 |
T642 |
T639 |
conj |
elegans,yeast |
R3340 |
T5482 |
T5481 |
acl |
containing,solution |
R3341 |
T5483 |
T5484 |
nummod |
4,% |
R3342 |
T5484 |
T5485 |
compound |
%,PFA |
R3343 |
T5485 |
T5482 |
dobj |
PFA,containing |
R3344 |
T5486 |
T5485 |
cc |
and,PFA |
R3345 |
T5487 |
T5488 |
nummod |
0.4,% |
R3346 |
T5488 |
T5489 |
compound |
%,100 |
R3347 |
T5489 |
T5485 |
conj |
100,PFA |
R3348 |
T5490 |
T5489 |
compound |
Triton,100 |
R3349 |
T5491 |
T5489 |
compound |
X,100 |
R335 |
T643 |
T642 |
punct |
", ",elegans |
R3350 |
T5492 |
T5489 |
punct |
-,100 |
R3351 |
T5493 |
T5478 |
prep |
at,incubated |
R3352 |
T5494 |
T5495 |
nummod |
4,°C |
R3353 |
T5495 |
T5493 |
pobj |
°C,at |
R3354 |
T5496 |
T5478 |
prep |
for,incubated |
R3355 |
T5497 |
T5498 |
nummod |
1,hr |
R3356 |
T5498 |
T5496 |
pobj |
hr,for |
R3357 |
T5499 |
T5451 |
punct |
.,fixed |
R3358 |
T5501 |
T5502 |
prep |
After,incubated |
R3359 |
T5503 |
T5501 |
pcomp |
washing,After |
R336 |
T644 |
T642 |
cc |
and,elegans |
R3360 |
T5504 |
T5503 |
prep |
with,washing |
R3361 |
T5505 |
T5504 |
pobj |
PBS,with |
R3362 |
T5506 |
T5507 |
nummod |
three,times |
R3363 |
T5507 |
T5503 |
npadvmod |
times,washing |
R3364 |
T5508 |
T5502 |
punct |
", ",incubated |
R3365 |
T5509 |
T5510 |
det |
the,cells |
R3366 |
T5510 |
T5502 |
nsubjpass |
cells,incubated |
R3367 |
T5511 |
T5502 |
auxpass |
were,incubated |
R3368 |
T5512 |
T5502 |
prep |
with,incubated |
R3369 |
T5513 |
T5514 |
det |
a,solution |
R337 |
T645 |
T646 |
compound |
D.,melanogaster |
R3370 |
T5514 |
T5512 |
pobj |
solution,with |
R3371 |
T5515 |
T5514 |
amod |
blocking,solution |
R3372 |
T5516 |
T5514 |
acl |
containing,solution |
R3373 |
T5517 |
T5518 |
nummod |
1,serum |
R3374 |
T5518 |
T5516 |
dobj |
serum,containing |
R3375 |
T5519 |
T5520 |
punct |
:,30 |
R3376 |
T5520 |
T5517 |
prep |
30,1 |
R3377 |
T5521 |
T5518 |
amod |
normal,serum |
R3378 |
T5522 |
T5518 |
compound |
goat,serum |
R3379 |
T5523 |
T5502 |
punct |
", ",incubated |
R338 |
T646 |
T642 |
conj |
melanogaster,elegans |
R3380 |
T5524 |
T5502 |
cc |
and,incubated |
R3381 |
T5525 |
T5526 |
advmod |
subsequently,incubated |
R3382 |
T5526 |
T5502 |
conj |
incubated,incubated |
R3383 |
T5527 |
T5526 |
prep |
with,incubated |
R3384 |
T5528 |
T5529 |
det |
a,antibody |
R3385 |
T5529 |
T5527 |
pobj |
antibody,with |
R3386 |
T5530 |
T5529 |
nmod |
rabbit,antibody |
R3387 |
T5531 |
T5529 |
amod |
polyclonal,antibody |
R3388 |
T5532 |
T5529 |
amod |
anti-ACDP,antibody |
R3389 |
T5533 |
T5534 |
punct |
(,1 |
R339 |
T647 |
T636 |
prep |
to,from |
R3390 |
T5534 |
T5529 |
parataxis |
1,antibody |
R3391 |
T5535 |
T5536 |
punct |
:,3000 |
R3392 |
T5536 |
T5534 |
prep |
3000,1 |
R3393 |
T5537 |
T5534 |
punct |
),1 |
R3394 |
T5538 |
T5526 |
advmod |
overnight,incubated |
R3395 |
T5539 |
T5526 |
prep |
at,incubated |
R3396 |
T5540 |
T5541 |
nummod |
4,°C |
R3397 |
T5541 |
T5539 |
pobj |
°C,at |
R3398 |
T5542 |
T5502 |
punct |
.,incubated |
R3399 |
T5544 |
T5545 |
prep |
After,incubated |
R340 |
T648 |
T647 |
pobj |
mammals,to |
R3400 |
T5546 |
T5547 |
amod |
extensive,washing |
R3401 |
T5547 |
T5544 |
pobj |
washing,After |
R3402 |
T5548 |
T5547 |
prep |
with,washing |
R3403 |
T5549 |
T5550 |
nummod |
1,% |
R3404 |
T5550 |
T5551 |
compound |
%,serum |
R3405 |
T5551 |
T5553 |
compound |
serum,solution |
R3406 |
T5552 |
T5551 |
compound |
goat,serum |
R3407 |
T5553 |
T5548 |
pobj |
solution,with |
R3408 |
T5554 |
T5553 |
compound |
PBS,solution |
R3409 |
T5555 |
T5545 |
punct |
", ",incubated |
R341 |
T649 |
T624 |
punct |
.,found |
R3410 |
T5556 |
T5557 |
det |
the,cells |
R3411 |
T5557 |
T5545 |
nsubjpass |
cells,incubated |
R3412 |
T5558 |
T5545 |
auxpass |
were,incubated |
R3413 |
T5559 |
T5545 |
prep |
with,incubated |
R3414 |
T5560 |
T5561 |
det |
an,antibody |
R3415 |
T5561 |
T5559 |
pobj |
antibody,with |
R3416 |
T5562 |
T5561 |
nmod |
Alex,antibody |
R3417 |
T5563 |
T5562 |
nummod |
488,Alex |
R3418 |
T5564 |
T5561 |
amod |
conjugated,antibody |
R3419 |
T5565 |
T5561 |
amod |
secondary,antibody |
R342 |
T651 |
T652 |
det |
The,conservation |
R3420 |
T5566 |
T5567 |
punct |
(,Probes |
R3421 |
T5567 |
T5561 |
parataxis |
Probes,antibody |
R3422 |
T5568 |
T5567 |
dep |
1,Probes |
R3423 |
T5569 |
T5570 |
punct |
:,100 |
R3424 |
T5570 |
T5568 |
prep |
100,1 |
R3425 |
T5571 |
T5568 |
prep |
in,1 |
R3426 |
T5572 |
T5573 |
nummod |
1,% |
R3427 |
T5573 |
T5574 |
compound |
%,serum |
R3428 |
T5574 |
T5576 |
compound |
serum,solution |
R3429 |
T5575 |
T5574 |
compound |
goat,serum |
R343 |
T652 |
T654 |
nsubj |
conservation,imply |
R3430 |
T5576 |
T5571 |
pobj |
solution,in |
R3431 |
T5577 |
T5576 |
compound |
PBS,solution |
R3432 |
T5578 |
T5567 |
punct |
", ",Probes |
R3433 |
T5579 |
T5567 |
compound |
Molecular,Probes |
R3434 |
T5580 |
T5567 |
punct |
),Probes |
R3435 |
T5581 |
T5545 |
prep |
for,incubated |
R3436 |
T5582 |
T5583 |
nummod |
3,hrs |
R3437 |
T5583 |
T5581 |
pobj |
hrs,for |
R3438 |
T5584 |
T5545 |
prep |
at,incubated |
R3439 |
T5585 |
T5586 |
compound |
room,temperature |
R344 |
T653 |
T652 |
compound |
sequence,conservation |
R3440 |
T5586 |
T5584 |
pobj |
temperature,at |
R3441 |
T5587 |
T5545 |
punct |
.,incubated |
R3442 |
T5589 |
T5590 |
prep |
Following,slipped |
R3443 |
T5591 |
T5592 |
amod |
final,washes |
R3444 |
T5592 |
T5589 |
pobj |
washes,Following |
R3445 |
T5593 |
T5592 |
prep |
with,washes |
R3446 |
T5594 |
T5595 |
nummod |
1,% |
R3447 |
T5595 |
T5596 |
compound |
%,serum |
R3448 |
T5596 |
T5598 |
compound |
serum,solution |
R3449 |
T5597 |
T5596 |
compound |
goat,serum |
R345 |
T655 |
T652 |
cc |
and,conservation |
R3450 |
T5598 |
T5593 |
pobj |
solution,with |
R3451 |
T5599 |
T5598 |
compound |
PBS,solution |
R3452 |
T5600 |
T5590 |
punct |
", ",slipped |
R3453 |
T5601 |
T5602 |
det |
the,cells |
R3454 |
T5602 |
T5590 |
nsubjpass |
cells,slipped |
R3455 |
T5603 |
T5602 |
amod |
neuronal,cells |
R3456 |
T5604 |
T5602 |
prep |
on,cells |
R3457 |
T5605 |
T5606 |
det |
the,coverslips |
R3458 |
T5606 |
T5604 |
pobj |
coverslips,on |
R3459 |
T5607 |
T5590 |
auxpass |
were,slipped |
R346 |
T656 |
T657 |
det |
the,presence |
R3460 |
T5608 |
T5590 |
dep |
cover,slipped |
R3461 |
T5609 |
T5590 |
punct |
-,slipped |
R3462 |
T5610 |
T5590 |
prep |
with,slipped |
R3463 |
T5611 |
T5612 |
det |
a,medium |
R3464 |
T5612 |
T5610 |
pobj |
medium,with |
R3465 |
T5613 |
T5614 |
npadvmod |
glycerol,based |
R3466 |
T5614 |
T5612 |
amod |
based,medium |
R3467 |
T5615 |
T5614 |
punct |
-,based |
R3468 |
T5616 |
T5612 |
amod |
anti-photobleach,medium |
R3469 |
T5617 |
T5590 |
punct |
.,slipped |
R347 |
T657 |
T652 |
conj |
presence,conservation |
R3470 |
T5619 |
T5620 |
det |
The,cells |
R3471 |
T5620 |
T5621 |
nsubjpass |
cells,viewed |
R3472 |
T5622 |
T5621 |
auxpass |
were,viewed |
R3473 |
T5623 |
T5621 |
prep |
under,viewed |
R3474 |
T5624 |
T5625 |
det |
a,microscope |
R3475 |
T5625 |
T5623 |
pobj |
microscope,under |
R3476 |
T5626 |
T5625 |
amod |
confocal,microscope |
R3477 |
T5627 |
T5628 |
punct |
(,Zeiss |
R3478 |
T5628 |
T5625 |
parataxis |
Zeiss,microscope |
R3479 |
T5629 |
T5628 |
compound |
Carl,Zeiss |
R348 |
T658 |
T657 |
prep |
of,presence |
R3480 |
T5630 |
T5628 |
punct |
),Zeiss |
R3481 |
T5631 |
T5621 |
punct |
.,viewed |
R3482 |
T5633 |
T5634 |
nsubjpass |
Images,captured |
R3483 |
T5635 |
T5634 |
auxpass |
were,captured |
R3484 |
T5636 |
T5634 |
prep |
with,captured |
R3485 |
T5637 |
T5638 |
det |
a,camera |
R3486 |
T5638 |
T5636 |
pobj |
camera,with |
R3487 |
T5639 |
T5638 |
compound |
CCD,camera |
R3488 |
T5640 |
T5634 |
cc |
and,captured |
R3489 |
T5641 |
T5634 |
conj |
acquired,captured |
R349 |
T659 |
T660 |
amod |
multiple,members |
R3490 |
T5642 |
T5641 |
prep |
by,acquired |
R3491 |
T5643 |
T5644 |
det |
the,software |
R3492 |
T5644 |
T5642 |
pobj |
software,by |
R3493 |
T5645 |
T5644 |
compound |
Scion,software |
R3494 |
T5646 |
T5644 |
compound |
Image,software |
R3495 |
T5647 |
T5648 |
punct |
(,Corporation |
R3496 |
T5648 |
T5644 |
parataxis |
Corporation,software |
R3497 |
T5649 |
T5648 |
compound |
Scion,Corporation |
R3498 |
T5650 |
T5648 |
punct |
", ",Corporation |
R3499 |
T5651 |
T5648 |
npadvmod |
Frederick,Corporation |
R350 |
T660 |
T658 |
pobj |
members,of |
R3500 |
T5652 |
T5648 |
punct |
", ",Corporation |
R3501 |
T5653 |
T5648 |
npadvmod |
MD,Corporation |
R3502 |
T5654 |
T5648 |
punct |
),Corporation |
R3503 |
T5655 |
T5634 |
punct |
.,captured |
R3504 |
T5677 |
T5678 |
compound |
Gene,bank |
R3505 |
T5678 |
T5679 |
compound |
bank,number |
R3506 |
T5680 |
T5679 |
compound |
accession,number |
R3507 |
T5682 |
T5683 |
det |
The,sequences |
R3508 |
T5683 |
T5685 |
nsubjpass |
sequences,deposited |
R3509 |
T5684 |
T5683 |
compound |
cDNA,sequences |
R351 |
T661 |
T657 |
prep |
within,presence |
R3510 |
T5686 |
T5683 |
prep |
for,sequences |
R3511 |
T5687 |
T5688 |
det |
the,family |
R3512 |
T5688 |
T5686 |
pobj |
family,for |
R3513 |
T5689 |
T5688 |
compound |
Acdp,family |
R3514 |
T5690 |
T5688 |
compound |
gene,family |
R3515 |
T5691 |
T5685 |
aux |
have,deposited |
R3516 |
T5692 |
T5685 |
advmod |
already,deposited |
R3517 |
T5693 |
T5685 |
auxpass |
been,deposited |
R3518 |
T5694 |
T5685 |
prep |
in,deposited |
R3519 |
T5695 |
T5696 |
compound |
gene,bank |
R352 |
T662 |
T663 |
det |
a,species |
R3520 |
T5696 |
T5694 |
pobj |
bank,in |
R3521 |
T5697 |
T5685 |
prep |
with,deposited |
R3522 |
T5698 |
T5699 |
compound |
accession,AF202994 |
R3523 |
T5699 |
T5697 |
pobj |
AF202994,with |
R3524 |
T5700 |
T5699 |
compound |
numbers,AF202994 |
R3525 |
T5701 |
T5699 |
punct |
(,AF202994 |
R3526 |
T5702 |
T5699 |
appos |
Acdp1,AF202994 |
R3527 |
T5703 |
T5699 |
punct |
),AF202994 |
R3528 |
T5704 |
T5699 |
punct |
", ",AF202994 |
R3529 |
T5705 |
T5699 |
conj |
AF216961,AF202994 |
R353 |
T663 |
T661 |
pobj |
species,within |
R3530 |
T5706 |
T5705 |
punct |
(,AF216961 |
R3531 |
T5707 |
T5705 |
appos |
Acdp2,AF216961 |
R3532 |
T5708 |
T5705 |
punct |
),AF216961 |
R3533 |
T5709 |
T5705 |
punct |
", ",AF216961 |
R3534 |
T5710 |
T5705 |
conj |
AF216964,AF216961 |
R3535 |
T5711 |
T5710 |
punct |
(,AF216964 |
R3536 |
T5712 |
T5710 |
appos |
Acdp3,AF216964 |
R3537 |
T5713 |
T5710 |
punct |
),AF216964 |
R3538 |
T5714 |
T5710 |
cc |
and,AF216964 |
R3539 |
T5715 |
T5710 |
conj |
AF216963,AF216964 |
R354 |
T664 |
T654 |
aux |
may,imply |
R3540 |
T5716 |
T5715 |
punct |
(,AF216963 |
R3541 |
T5717 |
T5715 |
appos |
Acdp4,AF216963 |
R3542 |
T5718 |
T5699 |
punct |
),AF202994 |
R3543 |
T5719 |
T5685 |
punct |
.,deposited |
R3544 |
T5731 |
T5732 |
compound |
Northern,blot |
R3545 |
T5732 |
T5733 |
compound |
blot,analyses |
R3546 |
T5734 |
T5733 |
prep |
of,analyses |
R3547 |
T5735 |
T5736 |
det |
the,family |
R3548 |
T5736 |
T5734 |
pobj |
family,of |
R3549 |
T5737 |
T5736 |
compound |
Acdp,family |
R355 |
T665 |
T666 |
amod |
functional,importance |
R3550 |
T5738 |
T5736 |
compound |
gene,family |
R3551 |
T5739 |
T5733 |
punct |
.,analyses |
R3552 |
T5741 |
T5742 |
compound |
S.,muscle |
R3553 |
T5742 |
T5743 |
nsubj |
muscle,represents |
R3554 |
T5744 |
T5745 |
amod |
skeletal,muscle |
R3555 |
T5745 |
T5743 |
dobj |
muscle,represents |
R3556 |
T5746 |
T5745 |
punct |
", ",muscle |
R3557 |
T5747 |
T5745 |
appos |
Sm,muscle |
R3558 |
T5748 |
T5743 |
punct |
.,represents |
R3559 |
T5750 |
T5751 |
nsubj |
Int.,represents |
R356 |
T666 |
T654 |
dobj |
importance,imply |
R3560 |
T5752 |
T5753 |
amod |
small,intestine |
R3561 |
T5753 |
T5751 |
dobj |
intestine,represents |
R3562 |
T5754 |
T5751 |
punct |
.,represents |
R3563 |
T5756 |
T5757 |
amod |
Multiple,Choice |
R3564 |
T5757 |
T5758 |
compound |
Choice,Blot |
R3565 |
T5758 |
T5760 |
compound |
Blot,filters |
R3566 |
T5759 |
T5758 |
compound |
Northern,Blot |
R3567 |
T5760 |
T5761 |
nsubjpass |
filters,purchased |
R3568 |
T5762 |
T5761 |
auxpass |
were,purchased |
R3569 |
T5763 |
T5761 |
prep |
from,purchased |
R357 |
T667 |
T666 |
acl |
associated,importance |
R3570 |
T5764 |
T5763 |
pobj |
Origene,from |
R3571 |
T5765 |
T5761 |
punct |
.,purchased |
R3572 |
T5826 |
T5827 |
compound |
Amino,acid |
R3573 |
T5827 |
T5828 |
compound |
acid,sequence |
R3574 |
T5828 |
T5829 |
compound |
sequence,alignment |
R3575 |
T5830 |
T5829 |
compound |
homology,alignment |
R3576 |
T5831 |
T5829 |
prep |
for,alignment |
R3577 |
T5832 |
T5831 |
pobj |
all,for |
R3578 |
T5833 |
T5832 |
prep |
of,all |
R3579 |
T5834 |
T5835 |
det |
the,genes |
R358 |
T668 |
T667 |
prep |
with,associated |
R3580 |
T5835 |
T5833 |
pobj |
genes,of |
R3581 |
T5836 |
T5835 |
nmod |
ACDP,genes |
R3582 |
T5837 |
T5836 |
cc |
and,ACDP |
R3583 |
T5838 |
T5836 |
conj |
Acdp,ACDP |
R3584 |
T5839 |
T5835 |
prep |
within,genes |
R3585 |
T5840 |
T5841 |
det |
the,domain |
R3586 |
T5841 |
T5839 |
pobj |
domain,within |
R3587 |
T5842 |
T5841 |
compound |
ACD,domain |
R3588 |
T5843 |
T5829 |
punct |
.,alignment |
R3589 |
T5845 |
T5846 |
det |
The,data |
R359 |
T669 |
T670 |
det |
the,genes |
R3590 |
T5846 |
T5848 |
nsubjpass |
data,deposited |
R3591 |
T5847 |
T5846 |
compound |
sequence,data |
R3592 |
T5849 |
T5846 |
prep |
for,data |
R3593 |
T5850 |
T5851 |
det |
the,genes |
R3594 |
T5851 |
T5849 |
pobj |
genes,for |
R3595 |
T5852 |
T5851 |
compound |
Acdp,genes |
R3596 |
T5853 |
T5848 |
aux |
have,deposited |
R3597 |
T5854 |
T5848 |
auxpass |
been,deposited |
R3598 |
T5855 |
T5848 |
prep |
in,deposited |
R3599 |
T5856 |
T5855 |
pobj |
GenBank,in |
R360 |
T670 |
T668 |
pobj |
genes,with |
R3600 |
T5857 |
T5848 |
prep |
under,deposited |
R3601 |
T5858 |
T5859 |
compound |
accession,AF202994 |
R3602 |
T5859 |
T5857 |
pobj |
AF202994,under |
R3603 |
T5860 |
T5859 |
compound |
number,AF202994 |
R3604 |
T5861 |
T5859 |
punct |
(,AF202994 |
R3605 |
T5862 |
T5859 |
appos |
Acdp1,AF202994 |
R3606 |
T5863 |
T5859 |
punct |
),AF202994 |
R3607 |
T5864 |
T5859 |
punct |
", ",AF202994 |
R3608 |
T5865 |
T5859 |
conj |
AF216961,AF202994 |
R3609 |
T5866 |
T5865 |
punct |
(,AF216961 |
R361 |
T671 |
T654 |
punct |
.,imply |
R3610 |
T5867 |
T5865 |
appos |
Acdp2,AF216961 |
R3611 |
T5868 |
T5865 |
punct |
),AF216961 |
R3612 |
T5869 |
T5865 |
punct |
", ",AF216961 |
R3613 |
T5870 |
T5865 |
conj |
AF216964,AF216961 |
R3614 |
T5871 |
T5870 |
punct |
(,AF216964 |
R3615 |
T5872 |
T5870 |
appos |
Acdp3,AF216964 |
R3616 |
T5873 |
T5870 |
punct |
),AF216964 |
R3617 |
T5874 |
T5870 |
cc |
and,AF216964 |
R3618 |
T5875 |
T5870 |
conj |
AF216963,AF216964 |
R3619 |
T5876 |
T5875 |
punct |
(,AF216963 |
R362 |
T673 |
T674 |
aux |
To,facilitate |
R3620 |
T5877 |
T5875 |
appos |
Acdp4,AF216963 |
R3621 |
T5878 |
T5859 |
punct |
),AF202994 |
R3622 |
T5879 |
T5848 |
punct |
.,deposited |
R3623 |
T5881 |
T5882 |
amod |
Identical,acids |
R3624 |
T5882 |
T5884 |
nsubjpass |
acids,shaded |
R3625 |
T5883 |
T5882 |
compound |
amino,acids |
R3626 |
T5885 |
T5882 |
cc |
or,acids |
R3627 |
T5886 |
T5887 |
compound |
amino,acids |
R3628 |
T5887 |
T5882 |
conj |
acids,acids |
R3629 |
T5888 |
T5887 |
prep |
with,acids |
R363 |
T674 |
T675 |
advcl |
facilitate,cloned |
R3630 |
T5889 |
T5890 |
advmod |
very,strong |
R3631 |
T5890 |
T5891 |
amod |
strong,homologies |
R3632 |
T5891 |
T5888 |
pobj |
homologies,with |
R3633 |
T5892 |
T5891 |
prep |
among,homologies |
R3634 |
T5893 |
T5894 |
det |
all,proteins |
R3635 |
T5894 |
T5892 |
pobj |
proteins,among |
R3636 |
T5895 |
T5884 |
auxpass |
were,shaded |
R3637 |
T5896 |
T5884 |
oprd |
black,shaded |
R3638 |
T5897 |
T5884 |
punct |
.,shaded |
R3639 |
T5899 |
T5900 |
amod |
Identical,acids |
R364 |
T676 |
T677 |
det |
the,analysis |
R3640 |
T5900 |
T5902 |
nsubjpass |
acids,shaded |
R3641 |
T5901 |
T5900 |
compound |
amino,acids |
R3642 |
T5903 |
T5900 |
cc |
or,acids |
R3643 |
T5904 |
T5905 |
compound |
amino,acids |
R3644 |
T5905 |
T5900 |
conj |
acids,acids |
R3645 |
T5906 |
T5905 |
prep |
with,acids |
R3646 |
T5907 |
T5908 |
advmod |
very,strong |
R3647 |
T5908 |
T5909 |
amod |
strong,homologies |
R3648 |
T5909 |
T5906 |
pobj |
homologies,with |
R3649 |
T5910 |
T5909 |
prep |
in,homologies |
R365 |
T677 |
T674 |
dobj |
analysis,facilitate |
R3650 |
T5911 |
T5910 |
pobj |
most,in |
R3651 |
T5912 |
T5911 |
prep |
of,most |
R3652 |
T5913 |
T5914 |
det |
the,proteins |
R3653 |
T5914 |
T5912 |
pobj |
proteins,of |
R3654 |
T5915 |
T5902 |
auxpass |
were,shaded |
R3655 |
T5916 |
T5902 |
oprd |
grey,shaded |
R3656 |
T5917 |
T5902 |
punct |
.,shaded |
R3657 |
T5919 |
T5920 |
compound |
Dot,lines |
R3658 |
T5920 |
T5921 |
nsubj |
lines,represent |
R3659 |
T5922 |
T5921 |
dobj |
gaps,represent |
R366 |
T678 |
T677 |
amod |
functional,analysis |
R3660 |
T5923 |
T5922 |
prep |
for,gaps |
R3661 |
T5924 |
T5925 |
det |
the,alignment |
R3662 |
T5925 |
T5923 |
pobj |
alignment,for |
R3663 |
T5926 |
T5921 |
punct |
.,represent |
R3664 |
T6010 |
T6011 |
compound |
Amino,acid |
R3665 |
T6011 |
T6012 |
compound |
acid,alignment |
R3666 |
T6013 |
T6012 |
compound |
sequence,alignment |
R3667 |
T6014 |
T6012 |
acl |
showing,alignment |
R3668 |
T6015 |
T6016 |
det |
the,conservation |
R3669 |
T6016 |
T6014 |
dobj |
conservation,showing |
R367 |
T679 |
T677 |
prep |
of,analysis |
R3670 |
T6017 |
T6016 |
prep |
of,conservation |
R3671 |
T6018 |
T6019 |
compound |
ACD,domain |
R3672 |
T6019 |
T6017 |
pobj |
domain,of |
R3673 |
T6020 |
T6014 |
prep |
in,showing |
R3674 |
T6021 |
T6022 |
amod |
various,species |
R3675 |
T6022 |
T6020 |
pobj |
species,in |
R3676 |
T6023 |
T6012 |
punct |
.,alignment |
R3677 |
T6025 |
T6026 |
nsubj |
Amip3,is |
R3678 |
T6027 |
T6028 |
det |
a,protein |
R3679 |
T6028 |
T6026 |
attr |
protein,is |
R368 |
T680 |
T681 |
det |
the,family |
R3680 |
T6029 |
T6028 |
prep |
from,protein |
R3681 |
T6030 |
T6031 |
compound |
Saccharomyces,cerevisiae |
R3682 |
T6031 |
T6029 |
pobj |
cerevisiae,from |
R3683 |
T6032 |
T6028 |
punct |
(,protein |
R3684 |
T6033 |
T6028 |
appos |
NP_014581,protein |
R3685 |
T6034 |
T6026 |
punct |
),is |
R3686 |
T6035 |
T6026 |
punct |
.,is |
R3687 |
T6037 |
T6038 |
nsubj |
CanG,is |
R3688 |
T6039 |
T6040 |
det |
a,protein |
R3689 |
T6040 |
T6038 |
attr |
protein,is |
R369 |
T681 |
T679 |
pobj |
family,of |
R3690 |
T6041 |
T6040 |
prep |
from,protein |
R3691 |
T6042 |
T6043 |
compound |
Candida,glabrata |
R3692 |
T6043 |
T6041 |
pobj |
glabrata,from |
R3693 |
T6044 |
T6040 |
punct |
(,protein |
R3694 |
T6045 |
T6040 |
appos |
AAF33142,protein |
R3695 |
T6046 |
T6038 |
punct |
),is |
R3696 |
T6047 |
T6038 |
punct |
.,is |
R3697 |
T6049 |
T6050 |
nsubj |
NeuC,is |
R3698 |
T6051 |
T6049 |
punct |
(,NeuC |
R3699 |
T6052 |
T6049 |
appos |
EAA31204,NeuC |
R370 |
T682 |
T681 |
compound |
ACDP,family |
R3700 |
T6053 |
T6050 |
punct |
),is |
R3701 |
T6054 |
T6055 |
det |
a,protein |
R3702 |
T6055 |
T6050 |
attr |
protein,is |
R3703 |
T6056 |
T6055 |
amod |
hypothetical,protein |
R3704 |
T6057 |
T6055 |
prep |
from,protein |
R3705 |
T6058 |
T6059 |
compound |
Neurospora,crassa |
R3706 |
T6059 |
T6057 |
pobj |
crassa,from |
R3707 |
T6060 |
T6050 |
punct |
.,is |
R3708 |
T6062 |
T6063 |
nsubj |
DroM,is |
R3709 |
T6064 |
T6065 |
det |
a,product |
R371 |
T683 |
T681 |
compound |
gene,family |
R3710 |
T6065 |
T6063 |
attr |
product,is |
R3711 |
T6066 |
T6065 |
compound |
gene,product |
R3712 |
T6067 |
T6065 |
prep |
from,product |
R3713 |
T6068 |
T6069 |
compound |
D.,melanogaster |
R3714 |
T6069 |
T6067 |
pobj |
melanogaster,from |
R3715 |
T6070 |
T6063 |
punct |
.,is |
R3716 |
T6072 |
T6073 |
det |
The,number |
R3717 |
T6073 |
T6075 |
nsubj |
number,is |
R3718 |
T6074 |
T6073 |
compound |
accession,number |
R3719 |
T6076 |
T6073 |
prep |
for,number |
R372 |
T684 |
T675 |
punct |
", ",cloned |
R3720 |
T6077 |
T6078 |
det |
this,gene |
R3721 |
T6078 |
T6076 |
pobj |
gene,for |
R3722 |
T6079 |
T6075 |
attr |
CG40084,is |
R3723 |
T6080 |
T6075 |
prep |
in,is |
R3724 |
T6081 |
T6080 |
pobj |
BDGP,in |
R3725 |
T6082 |
T6081 |
punct |
(,BDGP |
R3726 |
T6083 |
T6084 |
compound |
Berkeley,Project |
R3727 |
T6084 |
T6081 |
appos |
Project,BDGP |
R3728 |
T6085 |
T6084 |
compound |
Drosophila,Project |
R3729 |
T6086 |
T6084 |
compound |
Genome,Project |
R373 |
T685 |
T675 |
nsubj |
we,cloned |
R3730 |
T6087 |
T6075 |
punct |
),is |
R3731 |
T6088 |
T6075 |
punct |
.,is |
R3732 |
T6090 |
T6091 |
nsubj |
AnoG,represents |
R3733 |
T6092 |
T6093 |
det |
a,protein |
R3734 |
T6093 |
T6091 |
dobj |
protein,represents |
R3735 |
T6094 |
T6093 |
prep |
from,protein |
R3736 |
T6095 |
T6096 |
det |
the,str. |
R3737 |
T6096 |
T6094 |
pobj |
str.,from |
R3738 |
T6097 |
T6096 |
compound |
anopheles,str. |
R3739 |
T6098 |
T6096 |
compound |
gambiae,str. |
R374 |
T686 |
T675 |
cc |
and,cloned |
R3740 |
T6099 |
T6100 |
punct |
(,EAA01004 |
R3741 |
T6100 |
T6094 |
parataxis |
EAA01004,from |
R3742 |
T6101 |
T6100 |
punct |
),EAA01004 |
R3743 |
T6102 |
T6091 |
punct |
.,represents |
R3744 |
T6104 |
T6105 |
nsubj |
CaeE,is |
R3745 |
T6106 |
T6104 |
punct |
(,CaeE |
R3746 |
T6107 |
T6104 |
appos |
AAK77203,CaeE |
R3747 |
T6108 |
T6105 |
punct |
),is |
R3748 |
T6109 |
T6110 |
det |
a,protein |
R3749 |
T6110 |
T6105 |
attr |
protein,is |
R375 |
T687 |
T675 |
conj |
characterized,cloned |
R3750 |
T6111 |
T6110 |
amod |
hypothetical,protein |
R3751 |
T6112 |
T6110 |
prep |
from,protein |
R3752 |
T6113 |
T6114 |
det |
the,elegans |
R3753 |
T6114 |
T6112 |
pobj |
elegans,from |
R3754 |
T6115 |
T6114 |
compound |
Caenohabditis,elegans |
R3755 |
T6116 |
T6105 |
punct |
.,is |
R3756 |
T6118 |
T6119 |
nsubj |
CorC,represents |
R3757 |
T6120 |
T6121 |
compound |
bacteria,magnesium |
R3758 |
T6121 |
T6119 |
dobj |
magnesium,represents |
R3759 |
T6122 |
T6121 |
cc |
and,magnesium |
R376 |
T688 |
T687 |
dobj |
Acdp,characterized |
R3760 |
T6123 |
T6124 |
compound |
cobalt,protein |
R3761 |
T6124 |
T6121 |
conj |
protein,magnesium |
R3762 |
T6125 |
T6124 |
compound |
efflux,protein |
R3763 |
T6126 |
T6121 |
prep |
from,magnesium |
R3764 |
T6127 |
T6128 |
det |
the,oneidensis |
R3765 |
T6128 |
T6126 |
pobj |
oneidensis,from |
R3766 |
T6129 |
T6128 |
compound |
Shewanella,oneidensis |
R3767 |
T6130 |
T6119 |
punct |
.,represents |
R3768 |
T6132 |
T6133 |
nsubj |
XyFD,is |
R3769 |
T6134 |
T6135 |
det |
a,protein |
R377 |
T689 |
T688 |
punct |
", ",Acdp |
R3770 |
T6135 |
T6133 |
attr |
protein,is |
R3771 |
T6136 |
T6135 |
amod |
hypothetical,protein |
R3772 |
T6137 |
T6135 |
prep |
from,protein |
R3773 |
T6138 |
T6139 |
det |
the,Dixon |
R3774 |
T6139 |
T6137 |
pobj |
Dixon,from |
R3775 |
T6140 |
T6139 |
compound |
Xylella,Dixon |
R3776 |
T6141 |
T6139 |
compound |
fastidiosa,Dixon |
R3777 |
T6142 |
T6135 |
punct |
(,protein |
R3778 |
T6143 |
T6135 |
appos |
ZP_00038107,protein |
R3779 |
T6144 |
T6133 |
punct |
),is |
R378 |
T690 |
T691 |
det |
the,homologue |
R3780 |
T6145 |
T6133 |
punct |
.,is |
R3781 |
T6153 |
T6154 |
amod |
Phylogenetic,tree |
R3782 |
T6155 |
T6154 |
acl |
showing,tree |
R3783 |
T6156 |
T6155 |
dobj |
relationships,showing |
R3784 |
T6157 |
T6156 |
prep |
among,relationships |
R3785 |
T6158 |
T6157 |
pobj |
proteins,among |
R3786 |
T6159 |
T6158 |
acl |
containing,proteins |
R3787 |
T6160 |
T6161 |
det |
the,domain |
R3788 |
T6161 |
T6159 |
dobj |
domain,containing |
R3789 |
T6162 |
T6161 |
compound |
ACD,domain |
R379 |
T691 |
T688 |
appos |
homologue,Acdp |
R3790 |
T6163 |
T6161 |
prep |
from,domain |
R3791 |
T6164 |
T6165 |
nmod |
figure,2 |
R3792 |
T6165 |
T6163 |
pobj |
2,from |
R3793 |
T6166 |
T6165 |
cc |
and,2 |
R3794 |
T6167 |
T6165 |
conj |
3,2 |
R3795 |
T6168 |
T6154 |
punct |
.,tree |
R3796 |
T6170 |
T6171 |
det |
The,tree |
R3797 |
T6171 |
T6173 |
nsubjpass |
tree,constructed |
R3798 |
T6172 |
T6171 |
amod |
phylogenetic,tree |
R3799 |
T6174 |
T6173 |
auxpass |
was,constructed |
R380 |
T692 |
T691 |
compound |
mouse,homologue |
R3800 |
T6175 |
T6173 |
prep |
according,constructed |
R3801 |
T6176 |
T6175 |
prep |
to,according |
R3802 |
T6177 |
T6178 |
det |
the,calculation |
R3803 |
T6178 |
T6176 |
pobj |
calculation,to |
R3804 |
T6179 |
T6178 |
prep |
of,calculation |
R3805 |
T6180 |
T6181 |
det |
the,match |
R3806 |
T6181 |
T6179 |
pobj |
match,of |
R3807 |
T6182 |
T6181 |
amod |
best,match |
R3808 |
T6183 |
T6181 |
prep |
for,match |
R3809 |
T6184 |
T6185 |
det |
the,sequences |
R381 |
T693 |
T691 |
prep |
of,homologue |
R3810 |
T6185 |
T6183 |
pobj |
sequences,for |
R3811 |
T6186 |
T6185 |
amod |
selected,sequences |
R3812 |
T6187 |
T6173 |
punct |
.,constructed |
R3813 |
T6189 |
T6190 |
nsubj |
Abbreviations,are |
R3814 |
T6191 |
T6189 |
prep |
for,Abbreviations |
R3815 |
T6192 |
T6193 |
det |
each,protein |
R3816 |
T6193 |
T6191 |
pobj |
protein,for |
R3817 |
T6194 |
T6195 |
det |
the,same |
R3818 |
T6195 |
T6190 |
attr |
same,are |
R3819 |
T6196 |
T6197 |
mark |
as,presented |
R382 |
T694 |
T695 |
det |
the,family |
R3820 |
T6197 |
T6195 |
advcl |
presented,same |
R3821 |
T6198 |
T6197 |
prep |
in,presented |
R3822 |
T6199 |
T6198 |
pobj |
figure,in |
R3823 |
T6200 |
T6199 |
nummod |
3,figure |
R3824 |
T6201 |
T6190 |
punct |
.,are |
R3825 |
T6228 |
T6229 |
nummod |
Four,domains |
R3826 |
T6230 |
T6229 |
compound |
transmembrane,domains |
R3827 |
T6231 |
T6229 |
prep |
within,domains |
R3828 |
T6232 |
T6233 |
compound |
Acdp4,protein |
R3829 |
T6233 |
T6231 |
pobj |
protein,within |
R383 |
T695 |
T693 |
pobj |
family,of |
R3830 |
T6234 |
T6229 |
punct |
.,domains |
R3831 |
T6236 |
T6237 |
compound |
Transmembrane,domains |
R3832 |
T6237 |
T6238 |
nsubjpass |
domains,predicted |
R3833 |
T6239 |
T6238 |
auxpass |
were,predicted |
R3834 |
T6240 |
T6238 |
prep |
by,predicted |
R3835 |
T6241 |
T6242 |
det |
the,program |
R3836 |
T6242 |
T6240 |
pobj |
program,by |
R3837 |
T6243 |
T6242 |
compound |
TMHMM,program |
R3838 |
T6244 |
T6238 |
punct |
.,predicted |
R3839 |
T6246 |
T6247 |
det |
The,plot |
R384 |
T696 |
T695 |
amod |
human,family |
R3840 |
T6247 |
T6248 |
nsubj |
plot,shows |
R3841 |
T6249 |
T6250 |
det |
the,probabilities |
R3842 |
T6250 |
T6248 |
dobj |
probabilities,shows |
R3843 |
T6251 |
T6250 |
amod |
posterior,probabilities |
R3844 |
T6252 |
T6250 |
prep |
of,probabilities |
R3845 |
T6253 |
T6254 |
amod |
inside,TM |
R3846 |
T6254 |
T6258 |
compound |
TM,helix |
R3847 |
T6255 |
T6254 |
punct |
/,TM |
R3848 |
T6256 |
T6254 |
amod |
outside,TM |
R3849 |
T6257 |
T6254 |
punct |
/,TM |
R385 |
T697 |
T695 |
compound |
ACDP,family |
R3850 |
T6258 |
T6252 |
pobj |
helix,of |
R3851 |
T6259 |
T6248 |
punct |
.,shows |
R3852 |
T6261 |
T6262 |
prep |
At,shown |
R3853 |
T6263 |
T6264 |
det |
the,top |
R3854 |
T6264 |
T6261 |
pobj |
top,At |
R3855 |
T6265 |
T6264 |
prep |
of,top |
R3856 |
T6266 |
T6267 |
det |
the,plot |
R3857 |
T6267 |
T6265 |
pobj |
plot,of |
R3858 |
T6268 |
T6261 |
punct |
(,At |
R3859 |
T6269 |
T6261 |
prep |
between,At |
R386 |
T698 |
T695 |
compound |
gene,family |
R3860 |
T6270 |
T6269 |
pobj |
1,between |
R3861 |
T6271 |
T6270 |
cc |
and,1 |
R3862 |
T6272 |
T6270 |
conj |
1.2,1 |
R3863 |
T6273 |
T6262 |
punct |
),shown |
R3864 |
T6274 |
T6275 |
det |
the,prediction |
R3865 |
T6275 |
T6262 |
nsubjpass |
prediction,shown |
R3866 |
T6276 |
T6277 |
npadvmod |
N,best |
R3867 |
T6277 |
T6275 |
amod |
best,prediction |
R3868 |
T6278 |
T6277 |
punct |
-,best |
R3869 |
T6279 |
T6262 |
auxpass |
is,shown |
R387 |
T699 |
T675 |
punct |
.,cloned |
R3870 |
T6280 |
T6262 |
punct |
.,shown |
R3871 |
T6282 |
T6283 |
det |
The,plot |
R3872 |
T6283 |
T6284 |
nsubjpass |
plot,obtained |
R3873 |
T6285 |
T6284 |
auxpass |
is,obtained |
R3874 |
T6286 |
T6284 |
prep |
by,obtained |
R3875 |
T6287 |
T6286 |
pcomp |
calculating,by |
R3876 |
T6288 |
T6289 |
det |
the,probability |
R3877 |
T6289 |
T6287 |
dobj |
probability,calculating |
R3878 |
T6290 |
T6289 |
amod |
total,probability |
R3879 |
T6291 |
T6292 |
mark |
that,sits |
R388 |
T863 |
T864 |
amod |
Molecular,cloning |
R3880 |
T6292 |
T6289 |
acl |
sits,probability |
R3881 |
T6293 |
T6294 |
det |
a,residue |
R3882 |
T6294 |
T6292 |
nsubj |
residue,sits |
R3883 |
T6295 |
T6292 |
prep |
in,sits |
R3884 |
T6296 |
T6295 |
pobj |
helix,in |
R3885 |
T6297 |
T6292 |
punct |
", ",sits |
R3886 |
T6298 |
T6292 |
advmod |
inside,sits |
R3887 |
T6299 |
T6298 |
punct |
", ",inside |
R3888 |
T6300 |
T6298 |
cc |
or,inside |
R3889 |
T6301 |
T6298 |
conj |
outside,inside |
R389 |
T865 |
T864 |
prep |
of,cloning |
R3890 |
T6302 |
T6289 |
acl |
summed,probability |
R3891 |
T6303 |
T6302 |
prep |
over,summed |
R3892 |
T6304 |
T6305 |
det |
all,paths |
R3893 |
T6305 |
T6303 |
pobj |
paths,over |
R3894 |
T6306 |
T6305 |
amod |
possible,paths |
R3895 |
T6307 |
T6305 |
prep |
through,paths |
R3896 |
T6308 |
T6309 |
det |
the,model |
R3897 |
T6309 |
T6307 |
pobj |
model,through |
R3898 |
T6310 |
T6284 |
punct |
.,obtained |
R3899 |
T6368 |
T6369 |
dep |
Fig.,analysis |
R390 |
T866 |
T867 |
det |
the,family |
R3900 |
T6370 |
T6368 |
nummod |
6A,Fig. |
R3901 |
T6371 |
T6369 |
punct |
: ,analysis |
R3902 |
T6372 |
T6369 |
compound |
Immunoblot,analysis |
R3903 |
T6373 |
T6369 |
prep |
of,analysis |
R3904 |
T6374 |
T6375 |
compound |
Acdp,proteins |
R3905 |
T6375 |
T6373 |
pobj |
proteins,of |
R3906 |
T6376 |
T6375 |
prep |
in,proteins |
R3907 |
T6377 |
T6378 |
compound |
brain,tissue |
R3908 |
T6378 |
T6379 |
compound |
tissue,extracts |
R3909 |
T6379 |
T6376 |
pobj |
extracts,in |
R391 |
T867 |
T865 |
pobj |
family,of |
R3910 |
T6380 |
T6369 |
punct |
.,analysis |
R3911 |
T6382 |
T6383 |
nsubjpass |
Immunoblotting,carried |
R3912 |
T6384 |
T6383 |
auxpass |
were,carried |
R3913 |
T6385 |
T6383 |
prt |
out,carried |
R3914 |
T6386 |
T6383 |
advcl |
using,carried |
R3915 |
T6387 |
T6388 |
det |
a,system |
R3916 |
T6388 |
T6386 |
dobj |
system,using |
R3917 |
T6389 |
T6390 |
compound |
Western,blotting |
R3918 |
T6390 |
T6388 |
compound |
blotting,system |
R3919 |
T6391 |
T6388 |
compound |
detection,system |
R392 |
T868 |
T867 |
compound |
Acdp,family |
R3920 |
T6392 |
T6393 |
punct |
(,ECL |
R3921 |
T6393 |
T6386 |
parataxis |
ECL,using |
R3922 |
T6394 |
T6393 |
punct |
),ECL |
R3923 |
T6395 |
T6396 |
punct |
(,PIERCE |
R3924 |
T6396 |
T6386 |
parataxis |
PIERCE,using |
R3925 |
T6397 |
T6396 |
punct |
),PIERCE |
R3926 |
T6398 |
T6383 |
punct |
.,carried |
R3927 |
T6400 |
T6401 |
nsubj |
Lane,probed |
R3928 |
T6402 |
T6400 |
nummod |
1,Lane |
R3929 |
T6403 |
T6401 |
punct |
", ",probed |
R393 |
T869 |
T867 |
compound |
gene,family |
R3930 |
T6404 |
T6401 |
prep |
with,probed |
R3931 |
T6405 |
T6404 |
pobj |
antibody,with |
R3932 |
T6406 |
T6405 |
acl |
generated,antibody |
R3933 |
T6407 |
T6406 |
agent |
by,generated |
R3934 |
T6408 |
T6409 |
amod |
conserved,peptide |
R3935 |
T6409 |
T6407 |
pobj |
peptide,by |
R3936 |
T6410 |
T6401 |
punct |
.,probed |
R3937 |
T6412 |
T6413 |
prep |
From,band |
R3938 |
T6414 |
T6412 |
pobj |
top,From |
R3939 |
T6415 |
T6412 |
prep |
to,From |
R394 |
T871 |
T872 |
aux |
To,clone |
R3940 |
T6416 |
T6415 |
pobj |
bottom,to |
R3941 |
T6417 |
T6413 |
punct |
", ",band |
R3942 |
T6418 |
T6413 |
det |
each,band |
R3943 |
T6419 |
T6413 |
acl |
corresponding,band |
R3944 |
T6420 |
T6419 |
prep |
to,corresponding |
R3945 |
T6421 |
T6420 |
pobj |
Acdp1,to |
R3946 |
T6422 |
T6423 |
punct |
(,kD |
R3947 |
T6423 |
T6421 |
parataxis |
kD,Acdp1 |
R3948 |
T6424 |
T6423 |
nummod |
115,kD |
R3949 |
T6425 |
T6423 |
punct |
),kD |
R395 |
T872 |
T873 |
advcl |
clone,used |
R3950 |
T6426 |
T6421 |
punct |
", ",Acdp1 |
R3951 |
T6427 |
T6421 |
conj |
Acdp2,Acdp1 |
R3952 |
T6428 |
T6429 |
punct |
(,kD |
R3953 |
T6429 |
T6427 |
parataxis |
kD,Acdp2 |
R3954 |
T6430 |
T6429 |
nummod |
100,kD |
R3955 |
T6431 |
T6429 |
punct |
),kD |
R3956 |
T6432 |
T6427 |
punct |
", ",Acdp2 |
R3957 |
T6433 |
T6427 |
conj |
Acdp4,Acdp2 |
R3958 |
T6434 |
T6435 |
punct |
(,kD |
R3959 |
T6435 |
T6433 |
parataxis |
kD,Acdp4 |
R396 |
T874 |
T875 |
det |
the,genes |
R3960 |
T6436 |
T6435 |
nummod |
90,kD |
R3961 |
T6437 |
T6435 |
punct |
),kD |
R3962 |
T6438 |
T6433 |
cc |
and,Acdp4 |
R3963 |
T6439 |
T6433 |
conj |
Acdp3,Acdp4 |
R3964 |
T6440 |
T6441 |
punct |
(,kD |
R3965 |
T6441 |
T6439 |
parataxis |
kD,Acdp3 |
R3966 |
T6442 |
T6441 |
nummod |
80,kD |
R3967 |
T6443 |
T6441 |
punct |
),kD |
R3968 |
T6444 |
T6413 |
punct |
.,band |
R3969 |
T6446 |
T6447 |
nmod |
Lane,2 |
R397 |
T875 |
T872 |
dobj |
genes,clone |
R3970 |
T6447 |
T6448 |
nsubj |
2,probed |
R3971 |
T6449 |
T6447 |
cc |
and,2 |
R3972 |
T6450 |
T6447 |
conj |
3,2 |
R3973 |
T6451 |
T6448 |
punct |
", ",probed |
R3974 |
T6452 |
T6448 |
prep |
with,probed |
R3975 |
T6453 |
T6454 |
det |
the,antibodies |
R3976 |
T6454 |
T6452 |
pobj |
antibodies,with |
R3977 |
T6455 |
T6454 |
compound |
Acdp1,antibodies |
R3978 |
T6456 |
T6454 |
acl |
generated,antibodies |
R3979 |
T6457 |
T6456 |
agent |
by,generated |
R398 |
T876 |
T875 |
compound |
mouse,genes |
R3980 |
T6458 |
T6459 |
npadvmod |
N,terminal |
R3981 |
T6459 |
T6461 |
amod |
terminal,peptides |
R3982 |
T6460 |
T6459 |
punct |
-,terminal |
R3983 |
T6461 |
T6457 |
pobj |
peptides,by |
R3984 |
T6462 |
T6459 |
cc |
and,terminal |
R3985 |
T6463 |
T6464 |
npadvmod |
C,terminal |
R3986 |
T6464 |
T6459 |
conj |
terminal,terminal |
R3987 |
T6465 |
T6464 |
punct |
-,terminal |
R3988 |
T6466 |
T6456 |
punct |
", ",generated |
R3989 |
T6467 |
T6456 |
advmod |
respectively,generated |
R399 |
T877 |
T875 |
compound |
Acdp,genes |
R3990 |
T6468 |
T6448 |
punct |
.,probed |
R3991 |
T6470 |
T6471 |
dep |
Fig.,analysis |
R3992 |
T6472 |
T6470 |
nummod |
6B,Fig. |
R3993 |
T6473 |
T6471 |
punct |
: ,analysis |
R3994 |
T6474 |
T6471 |
compound |
Immunoblot,analysis |
R3995 |
T6475 |
T6471 |
prep |
of,analysis |
R3996 |
T6476 |
T6475 |
pobj |
Acdp1,of |
R3997 |
T6477 |
T6471 |
prep |
in,analysis |
R3998 |
T6478 |
T6479 |
nmod |
HEK293,cells |
R3999 |
T6479 |
T6477 |
pobj |
cells,in |
R400 |
T878 |
T873 |
punct |
", ",used |
R4000 |
T6480 |
T6478 |
punct |
", ",HEK293 |
R4001 |
T6481 |
T6478 |
conj |
3T3,HEK293 |
R4002 |
T6482 |
T6481 |
cc |
and,3T3 |
R4003 |
T6483 |
T6481 |
conj |
PC12,3T3 |
R4004 |
T6484 |
T6471 |
punct |
.,analysis |
R4005 |
T6486 |
T6487 |
det |
The,blots |
R4006 |
T6487 |
T6488 |
nsubjpass |
blots,probed |
R4007 |
T6489 |
T6488 |
auxpass |
were,probed |
R4008 |
T6490 |
T6488 |
prep |
with,probed |
R4009 |
T6491 |
T6492 |
det |
the,antibody |
R401 |
T879 |
T880 |
det |
the,cDNA |
R4010 |
T6492 |
T6490 |
pobj |
antibody,with |
R4011 |
T6493 |
T6492 |
prep |
against,antibody |
R4012 |
T6494 |
T6495 |
det |
the,terminus |
R4013 |
T6495 |
T6493 |
pobj |
terminus,against |
R4014 |
T6496 |
T6495 |
compound |
C,terminus |
R4015 |
T6497 |
T6495 |
punct |
-,terminus |
R4016 |
T6498 |
T6495 |
prep |
of,terminus |
R4017 |
T6499 |
T6498 |
pobj |
Acdp,of |
R4018 |
T6500 |
T6499 |
punct |
-,Acdp |
R4019 |
T6501 |
T6499 |
nummod |
1,Acdp |
R402 |
T880 |
T873 |
nsubjpass |
cDNA,used |
R4020 |
T6502 |
T6488 |
punct |
.,probed |
R4021 |
T6504 |
T6505 |
dep |
Lane,μg |
R4022 |
T6506 |
T6504 |
nummod |
1,Lane |
R4023 |
T6507 |
T6505 |
punct |
", ",μg |
R4024 |
T6508 |
T6505 |
nummod |
10,μg |
R4025 |
T6509 |
T6505 |
prep |
of,μg |
R4026 |
T6510 |
T6511 |
compound |
HEK293,lysates |
R4027 |
T6511 |
T6509 |
pobj |
lysates,of |
R4028 |
T6512 |
T6511 |
compound |
cell,lysates |
R4029 |
T6513 |
T6505 |
punct |
.,μg |
R403 |
T881 |
T880 |
amod |
human,cDNA |
R4030 |
T6515 |
T6516 |
nmod |
Lane,2 |
R4031 |
T6516 |
T6517 |
dep |
2,μg |
R4032 |
T6518 |
T6516 |
cc |
and,2 |
R4033 |
T6519 |
T6516 |
conj |
3,2 |
R4034 |
T6520 |
T6517 |
punct |
", ",μg |
R4035 |
T6521 |
T6517 |
nummod |
100,μg |
R4036 |
T6522 |
T6517 |
prep |
of,μg |
R4037 |
T6523 |
T6524 |
nmod |
3T3,lysates |
R4038 |
T6524 |
T6522 |
pobj |
lysates,of |
R4039 |
T6525 |
T6523 |
cc |
and,3T3 |
R404 |
T882 |
T880 |
compound |
ACDP,cDNA |
R4040 |
T6526 |
T6523 |
conj |
PC12,3T3 |
R4041 |
T6527 |
T6524 |
compound |
cell,lysates |
R4042 |
T6528 |
T6517 |
punct |
.,μg |
R4043 |
T6553 |
T6554 |
amod |
Subcellular,localization |
R4044 |
T6555 |
T6554 |
prep |
of,localization |
R4045 |
T6556 |
T6555 |
pobj |
Acdp1,of |
R4046 |
T6557 |
T6554 |
prep |
in,localization |
R4047 |
T6558 |
T6559 |
compound |
hippocampus,neurons |
R4048 |
T6559 |
T6557 |
pobj |
neurons,in |
R4049 |
T6560 |
T6554 |
punct |
.,localization |
R405 |
T883 |
T880 |
cc |
and,cDNA |
R4050 |
T6562 |
T6563 |
det |
A,series |
R4051 |
T6564 |
T6563 |
prep |
of,series |
R4052 |
T6565 |
T6566 |
amod |
confocal,images |
R4053 |
T6566 |
T6564 |
pobj |
images,of |
R4054 |
T6567 |
T6563 |
prep |
from,series |
R4055 |
T6568 |
T6569 |
det |
a,neuron |
R4056 |
T6569 |
T6567 |
pobj |
neuron,from |
R4057 |
T6570 |
T6569 |
amod |
cultured,neuron |
R4058 |
T6571 |
T6569 |
acl |
stained,neuron |
R4059 |
T6572 |
T6571 |
prep |
with,stained |
R406 |
T884 |
T885 |
amod |
predicted,sequences |
R4060 |
T6573 |
T6574 |
det |
an,antibody |
R4061 |
T6574 |
T6572 |
pobj |
antibody,with |
R4062 |
T6575 |
T6574 |
amod |
anti-Acdp1,antibody |
R4063 |
T6576 |
T6563 |
punct |
.,series |
R4064 |
T6578 |
T6579 |
det |
The,step |
R4065 |
T6579 |
T6580 |
nsubj |
step,is |
R4066 |
T6581 |
T6579 |
prep |
of,step |
R4067 |
T6582 |
T6583 |
det |
each,section |
R4068 |
T6583 |
T6581 |
pobj |
section,of |
R4069 |
T6584 |
T6583 |
compound |
imaging,section |
R407 |
T885 |
T880 |
conj |
sequences,cDNA |
R4070 |
T6585 |
T6586 |
nummod |
0.5,μm |
R4071 |
T6586 |
T6580 |
attr |
μm,is |
R4072 |
T6587 |
T6580 |
punct |
", ",is |
R4073 |
T6588 |
T6580 |
prep |
from,is |
R4074 |
T6589 |
T6590 |
det |
the,surface |
R4075 |
T6590 |
T6588 |
pobj |
surface,from |
R4076 |
T6591 |
T6590 |
prep |
of,surface |
R4077 |
T6592 |
T6593 |
det |
the,neuron |
R4078 |
T6593 |
T6591 |
pobj |
neuron,of |
R4079 |
T6594 |
T6595 |
punct |
(,μm |
R408 |
T886 |
T885 |
compound |
protein,sequences |
R4080 |
T6595 |
T6590 |
parataxis |
μm,surface |
R4081 |
T6596 |
T6595 |
nummod |
0,μm |
R4082 |
T6597 |
T6595 |
punct |
),μm |
R4083 |
T6598 |
T6588 |
prep |
to,from |
R4084 |
T6599 |
T6600 |
det |
the,plan |
R4085 |
T6600 |
T6598 |
pobj |
plan,to |
R4086 |
T6601 |
T6600 |
amod |
middle,plan |
R4087 |
T6602 |
T6603 |
punct |
(,μm |
R4088 |
T6603 |
T6600 |
parataxis |
μm,plan |
R4089 |
T6604 |
T6603 |
nummod |
4.5,μm |
R409 |
T887 |
T873 |
auxpass |
were,used |
R4090 |
T6605 |
T6603 |
punct |
),μm |
R4091 |
T6606 |
T6580 |
punct |
.,is |
R4092 |
T6623 |
T6624 |
nmod |
Nucleotide,homologies |
R4093 |
T6625 |
T6623 |
cc |
and,Nucleotide |
R4094 |
T6626 |
T6627 |
compound |
amino,acid |
R4095 |
T6627 |
T6623 |
conj |
acid,Nucleotide |
R4096 |
T6628 |
T6629 |
punct |
(,% |
R4097 |
T6629 |
T6624 |
parataxis |
%,homologies |
R4098 |
T6630 |
T6629 |
punct |
),% |
R4099 |
T6631 |
T6624 |
prep |
between,homologies |
R410 |
T888 |
T889 |
aux |
to,search |
R4100 |
T6632 |
T6633 |
amod |
human,ACDP |
R4101 |
T6633 |
T6634 |
nmod |
ACDP,members |
R4102 |
T6634 |
T6631 |
pobj |
members,between |
R4103 |
T6635 |
T6633 |
cc |
and,ACDP |
R4104 |
T6636 |
T6637 |
compound |
mouse,Acdp |
R4105 |
T6637 |
T6633 |
conj |
Acdp,ACDP |
R4106 |
T6638 |
T6624 |
punct |
.,homologies |
R411 |
T889 |
T873 |
advcl |
search,used |
R412 |
T890 |
T891 |
det |
the,database |
R413 |
T891 |
T889 |
dobj |
database,search |
R414 |
T892 |
T891 |
compound |
mouse,database |
R415 |
T893 |
T891 |
compound |
EST,database |
R416 |
T894 |
T889 |
prep |
with,search |
R417 |
T895 |
T896 |
det |
the,programs |
R418 |
T896 |
T894 |
pobj |
programs,with |
R419 |
T897 |
T896 |
nmod |
blastn,programs |
R420 |
T898 |
T897 |
cc |
and,blastn |
R421 |
T899 |
T897 |
conj |
tblastn,blastn |
R422 |
T900 |
T873 |
punct |
.,used |
R423 |
T902 |
T903 |
compound |
Mouse,markers |
R424 |
T903 |
T905 |
nsubjpass |
markers,identified |
R425 |
T904 |
T903 |
compound |
EST,markers |
R426 |
T906 |
T903 |
acl |
corresponding,markers |
R427 |
T907 |
T906 |
prep |
to,corresponding |
R428 |
T908 |
T909 |
det |
each,member |
R429 |
T909 |
T907 |
pobj |
member,to |
R430 |
T910 |
T909 |
compound |
Acdp,member |
R431 |
T911 |
T905 |
auxpass |
were,identified |
R432 |
T912 |
T905 |
advmod |
then,identified |
R433 |
T913 |
T905 |
punct |
.,identified |
R434 |
T915 |
T916 |
prep |
For,corresponds |
R435 |
T917 |
T915 |
pobj |
example,For |
R436 |
T918 |
T916 |
punct |
", ",corresponds |
R437 |
T919 |
T920 |
compound |
EST,H3086H12 |
R438 |
T920 |
T916 |
nsubj |
H3086H12,corresponds |
R439 |
T921 |
T920 |
punct |
-,H3086H12 |
R440 |
T922 |
T920 |
nummod |
5,H3086H12 |
R441 |
T923 |
T916 |
prep |
to,corresponds |
R442 |
T924 |
T923 |
pobj |
Acdp1,to |
R443 |
T925 |
T916 |
punct |
", ",corresponds |
R444 |
T926 |
T916 |
conj |
W98010,corresponds |
R445 |
T927 |
T926 |
prep |
for,W98010 |
R446 |
T928 |
T927 |
pobj |
Acdp2,for |
R447 |
T929 |
T926 |
punct |
", ",W98010 |
R448 |
T930 |
T926 |
conj |
603299135F1,W98010 |
R449 |
T931 |
T930 |
prep |
for,603299135F1 |
R450 |
T932 |
T931 |
pobj |
Acdp3,for |
R451 |
T933 |
T930 |
cc |
and,603299135F1 |
R452 |
T934 |
T930 |
conj |
BG083791,603299135F1 |
R453 |
T935 |
T934 |
prep |
for,BG083791 |
R454 |
T936 |
T935 |
pobj |
Acdp4,for |
R455 |
T937 |
T916 |
punct |
.,corresponds |
R456 |
T939 |
T940 |
det |
A,dT |
R457 |
T940 |
T944 |
nsubjpass |
dT,used |
R458 |
T941 |
T940 |
amod |
modified,dT |
R459 |
T942 |
T940 |
compound |
oligo,dT |
R460 |
T943 |
T940 |
punct |
-,dT |
R461 |
T945 |
T940 |
prep |
with,dT |
R462 |
T946 |
T947 |
det |
a,tail |
R463 |
T947 |
T945 |
pobj |
tail,with |
R464 |
T948 |
T947 |
compound |
M13,tail |
R465 |
T949 |
T944 |
auxpass |
was,used |
R466 |
T950 |
T944 |
prep |
for,used |
R467 |
T951 |
T952 |
det |
the,reaction |
R468 |
T952 |
T950 |
pobj |
reaction,for |
R469 |
T953 |
T952 |
compound |
RT,reaction |
R470 |
T954 |
T944 |
punct |
.,used |
R471 |
T956 |
T957 |
det |
A,primer |
R472 |
T957 |
T959 |
nsubjpass |
primer,used |
R473 |
T958 |
T957 |
amod |
forward,primer |
R474 |
T960 |
T957 |
prep |
from,primer |
R475 |
T961 |
T962 |
det |
each,marker |
R476 |
T962 |
T960 |
pobj |
marker,from |
R477 |
T963 |
T962 |
compound |
EST,marker |
R478 |
T964 |
T962 |
cc |
and,marker |
R479 |
T965 |
T966 |
det |
the,primer |
R480 |
T966 |
T962 |
conj |
primer,marker |
R481 |
T967 |
T966 |
compound |
M13,primer |
R482 |
T968 |
T966 |
punct |
(,primer |
R483 |
T969 |
T970 |
compound |
olig,dT |
R484 |
T970 |
T972 |
compound |
dT,tail |
R485 |
T971 |
T970 |
punct |
-,dT |
R486 |
T972 |
T966 |
appos |
tail,primer |
R487 |
T973 |
T966 |
punct |
),primer |
R488 |
T974 |
T959 |
auxpass |
were,used |
R489 |
T975 |
T976 |
aux |
to,amplify |
R490 |
T976 |
T959 |
advcl |
amplify,used |
R491 |
T977 |
T978 |
det |
the,sequence |
R492 |
T978 |
T976 |
dobj |
sequence,amplify |
R493 |
T979 |
T980 |
nummod |
3,UTR |
R494 |
T980 |
T978 |
compound |
UTR,sequence |
R495 |
T981 |
T979 |
punct |
',3 |
R496 |
T982 |
T976 |
prep |
for,amplify |
R497 |
T983 |
T984 |
det |
each,gene |
R498 |
T984 |
T982 |
pobj |
gene,for |
R499 |
T985 |
T984 |
amod |
corresponding,gene |
R500 |
T986 |
T984 |
compound |
Acdp,gene |
R501 |
T987 |
T984 |
prep |
from,gene |
R502 |
T988 |
T989 |
det |
the,products |
R503 |
T989 |
T987 |
pobj |
products,from |
R504 |
T990 |
T989 |
compound |
RT,products |
R505 |
T991 |
T959 |
punct |
.,used |
R506 |
T993 |
T994 |
aux |
To,obtain |
R507 |
T994 |
T995 |
advcl |
obtain,conducted |
R508 |
T996 |
T997 |
nummod |
5,end |
R509 |
T997 |
T1000 |
nmod |
end,sequences |
R510 |
T998 |
T996 |
punct |
',5 |
R511 |
T999 |
T997 |
punct |
-,end |
R512 |
T1000 |
T994 |
dobj |
sequences,obtain |
R513 |
T1001 |
T1000 |
amod |
coding,sequences |
R514 |
T1002 |
T994 |
prep |
for,obtain |
R515 |
T1003 |
T1004 |
det |
the,genes |
R516 |
T1004 |
T1002 |
pobj |
genes,for |
R517 |
T1005 |
T1004 |
compound |
Acdp,genes |
R518 |
T1006 |
T995 |
punct |
", ",conducted |
R519 |
T1007 |
T995 |
nsubj |
we,conducted |
R520 |
T1008 |
T1009 |
det |
a,PCR |
R521 |
T1009 |
T995 |
dobj |
PCR,conducted |
R522 |
T1010 |
T1011 |
npadvmod |
series,nested |
R523 |
T1011 |
T1009 |
amod |
nested,PCR |
R524 |
T1012 |
T995 |
prep |
with,conducted |
R525 |
T1013 |
T1012 |
pobj |
combinations,with |
R526 |
T1014 |
T1013 |
prep |
of,combinations |
R527 |
T1015 |
T1016 |
nmod |
mouse,primers |
R528 |
T1016 |
T1014 |
pobj |
primers,of |
R529 |
T1017 |
T1015 |
cc |
and,mouse |
R530 |
T1018 |
T1015 |
conj |
human,mouse |
R531 |
T1019 |
T995 |
punct |
.,conducted |
R532 |
T1021 |
T1022 |
det |
The,sequences |
R533 |
T1022 |
T1026 |
nsubjpass |
sequences,identified |
R534 |
T1023 |
T1022 |
nummod |
5,sequences |
R535 |
T1024 |
T1023 |
punct |
',5 |
R536 |
T1025 |
T1022 |
compound |
UTR,sequences |
R537 |
T1027 |
T1026 |
auxpass |
were,identified |
R538 |
T1028 |
T1026 |
prep |
by,identified |
R539 |
T1029 |
T1030 |
advmod |
directly,sequencing |
R540 |
T1030 |
T1028 |
pcomp |
sequencing,by |
R541 |
T1031 |
T1032 |
compound |
BAC,DNA |
R542 |
T1032 |
T1030 |
dobj |
DNA,sequencing |
R543 |
T1033 |
T1032 |
acl |
containing,DNA |
R544 |
T1034 |
T1035 |
det |
the,genes |
R545 |
T1035 |
T1033 |
dobj |
genes,containing |
R546 |
T1036 |
T1035 |
amod |
corresponding,genes |
R547 |
T1037 |
T1035 |
compound |
Acdp,genes |
R548 |
T1038 |
T1026 |
punct |
.,identified |
R549 |
T1040 |
T1041 |
det |
The,clones |
R550 |
T1041 |
T1043 |
nsubjpass |
clones,identified |
R551 |
T1042 |
T1041 |
compound |
BAC,clones |
R552 |
T1044 |
T1043 |
auxpass |
were,identified |
R553 |
T1045 |
T1043 |
prep |
by,identified |
R554 |
T1046 |
T1045 |
pcomp |
screening,by |
R555 |
T1047 |
T1048 |
det |
a,library |
R556 |
T1048 |
T1046 |
dobj |
library,screening |
R557 |
T1049 |
T1050 |
compound |
CITB,DNA |
R558 |
T1050 |
T1048 |
compound |
DNA,library |
R559 |
T1051 |
T1050 |
compound |
mouse,DNA |
R560 |
T1052 |
T1050 |
compound |
BAC,DNA |
R561 |
T1053 |
T1054 |
punct |
(,Genetics |
R562 |
T1054 |
T1048 |
parataxis |
Genetics,library |
R563 |
T1055 |
T1054 |
compound |
Research,Genetics |
R564 |
T1056 |
T1054 |
punct |
),Genetics |
R565 |
T1057 |
T1043 |
punct |
.,identified |
R566 |
T1059 |
T1060 |
det |
The,sequences |
R567 |
T1060 |
T1064 |
nsubjpass |
sequences,confirmed |
R568 |
T1061 |
T1060 |
nummod |
5,sequences |
R569 |
T1062 |
T1061 |
punct |
',5 |
R570 |
T1063 |
T1060 |
compound |
UTR,sequences |
R571 |
T1065 |
T1060 |
acl |
obtained,sequences |
R572 |
T1066 |
T1065 |
prep |
from,obtained |
R573 |
T1067 |
T1066 |
pcomp |
above,from |
R574 |
T1068 |
T1064 |
auxpass |
were,confirmed |
R575 |
T1069 |
T1064 |
advmod |
further,confirmed |
R576 |
T1070 |
T1064 |
prep |
by,confirmed |
R577 |
T1071 |
T1072 |
compound |
RT,PCR |
R578 |
T1072 |
T1070 |
pobj |
PCR,by |
R579 |
T1073 |
T1072 |
punct |
-,PCR |
R580 |
T1074 |
T1064 |
punct |
.,confirmed |
R581 |
T1076 |
T1077 |
det |
The,gene |
R582 |
T1077 |
T1079 |
nsubj |
gene,contains |
R583 |
T1078 |
T1077 |
compound |
Acdp1,gene |
R584 |
T1080 |
T1081 |
nummod |
"3,631",bp |
R585 |
T1081 |
T1079 |
dobj |
bp,contains |
R586 |
T1082 |
T1081 |
prep |
of,bp |
R587 |
T1083 |
T1084 |
compound |
nucleotide,sequence |
R588 |
T1084 |
T1082 |
pobj |
sequence,of |
R589 |
T1085 |
T1079 |
cc |
and,contains |
R590 |
T1086 |
T1079 |
conj |
encodes,contains |
R591 |
T1087 |
T1088 |
det |
a,protein |
R592 |
T1088 |
T1086 |
dobj |
protein,encodes |
R593 |
T1089 |
T1088 |
amod |
predicted,protein |
R594 |
T1090 |
T1086 |
prep |
with,encodes |
R595 |
T1091 |
T1092 |
nummod |
951,acids |
R596 |
T1092 |
T1090 |
pobj |
acids,with |
R597 |
T1093 |
T1092 |
compound |
amino,acids |
R598 |
T1094 |
T1095 |
punct |
(,AA |
R599 |
T1095 |
T1086 |
parataxis |
AA,encodes |
R600 |
T1096 |
T1095 |
punct |
),AA |
R601 |
T1097 |
T1079 |
punct |
.,contains |
R602 |
T1099 |
T1100 |
det |
The,genes |
R603 |
T1100 |
T1104 |
nsubj |
genes,contain |
R604 |
T1101 |
T1100 |
amod |
other,genes |
R605 |
T1102 |
T1100 |
nummod |
three,genes |
R606 |
T1103 |
T1100 |
compound |
Acdp,genes |
R607 |
T1105 |
T1100 |
punct |
(,genes |
R608 |
T1106 |
T1100 |
appos |
Acdp2,genes |
R609 |
T1107 |
T1106 |
punct |
", ",Acdp2 |
R610 |
T1108 |
T1106 |
nummod |
3,Acdp2 |
R611 |
T1109 |
T1106 |
cc |
and,Acdp2 |
R612 |
T1110 |
T1106 |
conj |
4,Acdp2 |
R613 |
T1111 |
T1100 |
punct |
),genes |
R614 |
T1112 |
T1113 |
nummod |
"3,244",bp |
R615 |
T1113 |
T1104 |
dobj |
bp,contain |
R616 |
T1114 |
T1113 |
punct |
", ",bp |
R617 |
T1115 |
T1116 |
nummod |
"2,684",bp |
R618 |
T1116 |
T1113 |
conj |
bp,bp |
R619 |
T1117 |
T1116 |
cc |
and,bp |
R620 |
T1118 |
T1119 |
nummod |
"2,743",bp |
R621 |
T1119 |
T1116 |
conj |
bp,bp |
R622 |
T1120 |
T1113 |
prep |
of,bp |
R623 |
T1121 |
T1122 |
compound |
cDNA,sequences |
R624 |
T1122 |
T1120 |
pobj |
sequences,of |
R625 |
T1123 |
T1104 |
punct |
", ",contain |
R626 |
T1124 |
T1104 |
cc |
and,contain |
R627 |
T1125 |
T1104 |
conj |
encode,contain |
R628 |
T1126 |
T1127 |
amod |
deduced,proteins |
R629 |
T1127 |
T1125 |
dobj |
proteins,encode |
R630 |
T1128 |
T1127 |
prep |
of,proteins |
R631 |
T1129 |
T1130 |
nummod |
874,acids |
R632 |
T1130 |
T1128 |
pobj |
acids,of |
R633 |
T1131 |
T1130 |
compound |
amino,acids |
R634 |
T1132 |
T1130 |
punct |
", ",acids |
R635 |
T1133 |
T1134 |
nummod |
713,acids |
R636 |
T1134 |
T1130 |
conj |
acids,acids |
R637 |
T1135 |
T1134 |
compound |
amino,acids |
R638 |
T1136 |
T1134 |
cc |
and,acids |
R639 |
T1137 |
T1138 |
nummod |
771,acids |
R640 |
T1138 |
T1134 |
conj |
acids,acids |
R641 |
T1139 |
T1138 |
compound |
amino,acids |
R642 |
T1140 |
T1125 |
punct |
", ",encode |
R643 |
T1141 |
T1125 |
advmod |
respectively,encode |
R644 |
T1142 |
T1104 |
punct |
.,contain |
R645 |
T1296 |
T1297 |
compound |
Tissue,distribution |
R646 |
T1299 |
T1300 |
compound |
Northern,blot |
R647 |
T1300 |
T1301 |
compound |
blot,analyses |
R648 |
T1301 |
T1302 |
nsubjpass |
analyses,carried |
R649 |
T1303 |
T1301 |
prep |
of,analyses |
R650 |
T1304 |
T1305 |
det |
the,family |
R651 |
T1305 |
T1303 |
pobj |
family,of |
R652 |
T1306 |
T1305 |
compound |
Acdp,family |
R653 |
T1307 |
T1305 |
compound |
gene,family |
R654 |
T1308 |
T1302 |
auxpass |
were,carried |
R655 |
T1309 |
T1302 |
prt |
out,carried |
R656 |
T1310 |
T1302 |
advcl |
using,carried |
R657 |
T1311 |
T1310 |
dobj |
membranes,using |
R658 |
T1312 |
T1311 |
acl |
purchased,membranes |
R659 |
T1313 |
T1312 |
prep |
from,purchased |
R660 |
T1314 |
T1313 |
pobj |
Origene,from |
R661 |
T1315 |
T1302 |
punct |
.,carried |
R662 |
T1317 |
T1318 |
det |
A,total |
R663 |
T1318 |
T1319 |
nsubjpass |
total,included |
R664 |
T1320 |
T1318 |
prep |
of,total |
R665 |
T1321 |
T1322 |
nummod |
12,tissues |
R666 |
T1322 |
T1320 |
pobj |
tissues,of |
R667 |
T1323 |
T1322 |
compound |
mouse,tissues |
R668 |
T1324 |
T1319 |
auxpass |
were,included |
R669 |
T1325 |
T1319 |
prep |
in,included |
R670 |
T1326 |
T1327 |
det |
the,study |
R671 |
T1327 |
T1325 |
pobj |
study,in |
R672 |
T1328 |
T1329 |
punct |
(,Fig. |
R673 |
T1329 |
T1319 |
parataxis |
Fig.,included |
R674 |
T1330 |
T1329 |
nummod |
1,Fig. |
R675 |
T1331 |
T1329 |
punct |
),Fig. |
R676 |
T1332 |
T1319 |
punct |
.,included |
R677 |
T1334 |
T1335 |
prep |
Due,were |
R678 |
T1336 |
T1334 |
pcomp |
to,Due |
R679 |
T1337 |
T1338 |
compound |
sequence,homologies |
R680 |
T1338 |
T1334 |
pobj |
homologies,Due |
R681 |
T1339 |
T1338 |
prep |
between,homologies |
R682 |
T1340 |
T1341 |
det |
each,member |
R683 |
T1341 |
T1339 |
pobj |
member,between |
R684 |
T1342 |
T1341 |
compound |
Acdp,member |
R685 |
T1343 |
T1341 |
prep |
within,member |
R686 |
T1344 |
T1345 |
det |
the,domain |
R687 |
T1345 |
T1343 |
pobj |
domain,within |
R688 |
T1346 |
T1345 |
amod |
conserved,domain |
R689 |
T1347 |
T1335 |
punct |
", ",were |
R690 |
T1348 |
T1335 |
nsubj |
probes,were |
R691 |
T1349 |
T1348 |
prep |
for,probes |
R692 |
T1350 |
T1351 |
compound |
Northern,bolts |
R693 |
T1351 |
T1349 |
pobj |
bolts,for |
R694 |
T1352 |
T1353 |
compound |
PCR,fragments |
R695 |
T1353 |
T1335 |
attr |
fragments,were |
R696 |
T1354 |
T1353 |
prep |
from,fragments |
R697 |
T1355 |
T1356 |
det |
the,exon |
R698 |
T1356 |
T1354 |
pobj |
exon,from |
R699 |
T1357 |
T1356 |
amod |
last,exon |
R700 |
T1358 |
T1356 |
cc |
and,exon |
R701 |
T1359 |
T1360 |
det |
the,sequences |
R702 |
T1360 |
T1356 |
conj |
sequences,exon |
R703 |
T1361 |
T1362 |
nummod |
3,region |
R704 |
T1362 |
T1360 |
compound |
region,sequences |
R705 |
T1363 |
T1361 |
punct |
',3 |
R706 |
T1364 |
T1362 |
amod |
untranslated,region |
R707 |
T1365 |
T1335 |
punct |
.,were |
R708 |
T1367 |
T1368 |
det |
The,messages |
R709 |
T1368 |
T1371 |
nsubj |
messages,showed |
R710 |
T1369 |
T1368 |
compound |
mouse,messages |
R711 |
T1370 |
T1368 |
compound |
Acdp,messages |
R712 |
T1372 |
T1373 |
advmod |
almost,distributions |
R713 |
T1373 |
T1371 |
dobj |
distributions,showed |
R714 |
T1374 |
T1373 |
det |
the,distributions |
R715 |
T1375 |
T1373 |
amod |
same,distributions |
R716 |
T1376 |
T1373 |
compound |
tissue,distributions |
R717 |
T1377 |
T1373 |
prep |
as,distributions |
R718 |
T1378 |
T1379 |
det |
the,genes |
R719 |
T1379 |
T1377 |
pobj |
genes,as |
R720 |
T1380 |
T1379 |
amod |
human,genes |
R721 |
T1381 |
T1379 |
compound |
ACDP,genes |
R722 |
T1382 |
T1371 |
punct |
.,showed |
R723 |
T1384 |
T1385 |
compound |
Acdp1,message |
R724 |
T1385 |
T1386 |
nsubjpass |
message,expressed |
R725 |
T1387 |
T1386 |
auxpass |
is,expressed |
R726 |
T1388 |
T1386 |
advmod |
highly,expressed |
R727 |
T1389 |
T1386 |
prep |
in,expressed |
R728 |
T1390 |
T1391 |
det |
the,brain |
R729 |
T1391 |
T1389 |
pobj |
brain,in |
R730 |
T1392 |
T1386 |
punct |
", ",expressed |
R731 |
T1393 |
T1394 |
mark |
while,showed |
R732 |
T1394 |
T1386 |
advcl |
showed,expressed |
R733 |
T1395 |
T1394 |
nsubj |
kidney,showed |
R734 |
T1396 |
T1395 |
cc |
and,kidney |
R735 |
T1397 |
T1395 |
conj |
testis,kidney |
R736 |
T1398 |
T1394 |
advmod |
also,showed |
R737 |
T1399 |
T1400 |
amod |
low,levels |
R738 |
T1400 |
T1394 |
dobj |
levels,showed |
R739 |
T1401 |
T1400 |
prep |
of,levels |
R740 |
T1402 |
T1401 |
pobj |
expression,of |
R741 |
T1403 |
T1386 |
punct |
.,expressed |
R742 |
T1405 |
T1406 |
nsubj |
Acdp2,showed |
R743 |
T1407 |
T1408 |
amod |
higher,expressions |
R744 |
T1408 |
T1406 |
dobj |
expressions,showed |
R745 |
T1409 |
T1406 |
prep |
in,showed |
R746 |
T1410 |
T1411 |
det |
the,brain |
R747 |
T1411 |
T1409 |
pobj |
brain,in |
R748 |
T1412 |
T1411 |
punct |
", ",brain |
R749 |
T1413 |
T1411 |
conj |
kidney,brain |
R750 |
T1414 |
T1413 |
cc |
and,kidney |
R751 |
T1415 |
T1413 |
conj |
liver,kidney |
R752 |
T1416 |
T1406 |
punct |
.,showed |
R753 |
T1418 |
T1419 |
advmod |
However,was |
R754 |
T1420 |
T1419 |
punct |
", ",was |
R755 |
T1421 |
T1422 |
det |
the,transcript |
R756 |
T1422 |
T1419 |
nsubj |
transcript,was |
R757 |
T1423 |
T1422 |
compound |
Acdp2,transcript |
R758 |
T1424 |
T1419 |
neg |
not,was |
R759 |
T1425 |
T1419 |
acomp |
present,was |
R760 |
T1426 |
T1419 |
prep |
in,was |
R761 |
T1427 |
T1428 |
det |
the,muscle |
R762 |
T1428 |
T1426 |
pobj |
muscle,in |
R763 |
T1429 |
T1428 |
compound |
skeleton,muscle |
R764 |
T1430 |
T1428 |
cc |
and,muscle |
R765 |
T1431 |
T1428 |
conj |
skin,muscle |
R766 |
T1432 |
T1419 |
punct |
", ",was |
R767 |
T1433 |
T1419 |
cc |
and,was |
R768 |
T1434 |
T1435 |
nsubj |
it,showed |
R769 |
T1435 |
T1419 |
conj |
showed,was |
R770 |
T1436 |
T1437 |
advmod |
very,low |
R771 |
T1437 |
T1438 |
amod |
low,levels |
R772 |
T1438 |
T1435 |
dobj |
levels,showed |
R773 |
T1439 |
T1438 |
prep |
of,levels |
R774 |
T1440 |
T1439 |
pobj |
expression,of |
R775 |
T1441 |
T1435 |
prep |
in,showed |
R776 |
T1442 |
T1443 |
det |
the,rest |
R777 |
T1443 |
T1441 |
pobj |
rest,in |
R778 |
T1444 |
T1443 |
prep |
of,rest |
R779 |
T1445 |
T1444 |
pobj |
tissues,of |
R780 |
T1446 |
T1435 |
punct |
.,showed |
R781 |
T1448 |
T1449 |
nsubj |
Acdp3,showed |
R782 |
T1449 |
T1452 |
ccomp |
showed,observed |
R783 |
T1450 |
T1448 |
cc |
and,Acdp3 |
R784 |
T1451 |
T1448 |
conj |
Acdp4,Acdp3 |
R785 |
T1453 |
T1454 |
amod |
different,levels |
R786 |
T1454 |
T1449 |
dobj |
levels,showed |
R787 |
T1455 |
T1454 |
prep |
of,levels |
R788 |
T1456 |
T1455 |
pobj |
expression,of |
R789 |
T1457 |
T1449 |
prep |
in,showed |
R790 |
T1458 |
T1459 |
det |
all,tissues |
R791 |
T1459 |
T1457 |
pobj |
tissues,in |
R792 |
T1460 |
T1459 |
acl |
tested,tissues |
R793 |
T1461 |
T1452 |
punct |
;,observed |
R794 |
T1462 |
T1463 |
det |
the,expressions |
R795 |
T1463 |
T1452 |
nsubjpass |
expressions,observed |
R796 |
T1464 |
T1463 |
amod |
highest,expressions |
R797 |
T1465 |
T1463 |
prep |
for,expressions |
R798 |
T1466 |
T1465 |
pobj |
Acdp3,for |
R799 |
T1467 |
T1452 |
auxpass |
were,observed |
R800 |
T1468 |
T1452 |
prep |
in,observed |
R801 |
T1469 |
T1470 |
det |
the,brain |
R802 |
T1470 |
T1468 |
pobj |
brain,in |
R803 |
T1471 |
T1470 |
punct |
", ",brain |
R804 |
T1472 |
T1470 |
conj |
kidney,brain |
R805 |
T1473 |
T1472 |
punct |
", ",kidney |
R806 |
T1474 |
T1472 |
conj |
liver,kidney |
R807 |
T1475 |
T1474 |
cc |
and,liver |
R808 |
T1476 |
T1474 |
conj |
heart,liver |
R809 |
T1477 |
T1452 |
punct |
", ",observed |
R810 |
T1478 |
T1452 |
cc |
and,observed |
R811 |
T1479 |
T1480 |
det |
the,expressions |
R812 |
T1480 |
T1482 |
nsubjpass |
expressions,observed |
R813 |
T1481 |
T1480 |
amod |
highest,expressions |
R814 |
T1482 |
T1452 |
conj |
observed,observed |
R815 |
T1483 |
T1480 |
prep |
for,expressions |
R816 |
T1484 |
T1483 |
pobj |
Acdp4,for |
R817 |
T1485 |
T1482 |
auxpass |
were,observed |
R818 |
T1486 |
T1482 |
prep |
in,observed |
R819 |
T1487 |
T1488 |
det |
the,kidney |
R820 |
T1488 |
T1486 |
pobj |
kidney,in |
R821 |
T1489 |
T1488 |
punct |
", ",kidney |
R822 |
T1490 |
T1491 |
amod |
small,intestine |
R823 |
T1491 |
T1488 |
conj |
intestine,kidney |
R824 |
T1492 |
T1491 |
cc |
and,intestine |
R825 |
T1493 |
T1491 |
conj |
testis,intestine |
R826 |
T1494 |
T1452 |
punct |
.,observed |
R827 |
T1496 |
T1497 |
det |
The,levels |
R828 |
T1497 |
T1499 |
nsubj |
levels,were |
R829 |
T1498 |
T1497 |
compound |
expression,levels |
R830 |
T1499 |
T1507 |
ccomp |
were,showed |
R831 |
T1500 |
T1497 |
prep |
for,levels |
R832 |
T1501 |
T1500 |
pobj |
Acdp3,for |
R833 |
T1502 |
T1501 |
cc |
and,Acdp3 |
R834 |
T1503 |
T1501 |
conj |
4,Acdp3 |
R835 |
T1504 |
T1497 |
prep |
in,levels |
R836 |
T1505 |
T1506 |
compound |
skeleton,muscle |
R837 |
T1506 |
T1504 |
pobj |
muscle,in |
R838 |
T1508 |
T1509 |
advmod |
barely,detectable |
R839 |
T1509 |
T1499 |
acomp |
detectable,were |
R840 |
T1510 |
T1507 |
punct |
;,showed |
R841 |
T1511 |
T1507 |
advmod |
however,showed |
R842 |
T1512 |
T1507 |
punct |
", ",showed |
R843 |
T1513 |
T1514 |
compound |
β,actin |
R844 |
T1514 |
T1507 |
nsubj |
actin,showed |
R845 |
T1515 |
T1514 |
punct |
-,actin |
R846 |
T1516 |
T1517 |
amod |
normal,expression |
R847 |
T1517 |
T1507 |
dobj |
expression,showed |
R848 |
T1518 |
T1507 |
advcl |
suggesting,showed |
R849 |
T1519 |
T1520 |
mark |
that,were |
R850 |
T1520 |
T1518 |
ccomp |
were,suggesting |
R851 |
T1521 |
T1522 |
det |
the,results |
R852 |
T1522 |
T1520 |
nsubj |
results,were |
R853 |
T1523 |
T1520 |
neg |
not,were |
R854 |
T1524 |
T1525 |
det |
a,consequence |
R855 |
T1525 |
T1520 |
attr |
consequence,were |
R856 |
T1526 |
T1525 |
prep |
of,consequence |
R857 |
T1527 |
T1528 |
amod |
bad,quality |
R858 |
T1528 |
T1526 |
pobj |
quality,of |
R859 |
T1529 |
T1528 |
compound |
RNA,quality |
R860 |
T1530 |
T1531 |
punct |
(,shown |
R861 |
T1531 |
T1507 |
parataxis |
shown,showed |
R862 |
T1532 |
T1531 |
nsubj |
data,shown |
R863 |
T1533 |
T1531 |
neg |
not,shown |
R864 |
T1534 |
T1531 |
punct |
),shown |
R865 |
T1535 |
T1507 |
punct |
.,showed |
R866 |
T1537 |
T1538 |
det |
The,pattern |
R867 |
T1538 |
T1541 |
nsubjpass |
pattern,taken |
R868 |
T1539 |
T1538 |
amod |
ubiquitous,pattern |
R869 |
T1540 |
T1538 |
compound |
expression,pattern |
R870 |
T1542 |
T1541 |
aux |
may,taken |
R871 |
T1543 |
T1541 |
auxpass |
be,taken |
R872 |
T1544 |
T1541 |
prep |
as,taken |
R873 |
T1545 |
T1546 |
det |
another,indication |
R874 |
T1546 |
T1544 |
pobj |
indication,as |
R875 |
T1547 |
T1546 |
prep |
of,indication |
R876 |
T1548 |
T1549 |
det |
the,importance |
R877 |
T1549 |
T1547 |
pobj |
importance,of |
R878 |
T1550 |
T1549 |
amod |
functional,importance |
R879 |
T1551 |
T1549 |
prep |
of,importance |
R880 |
T1552 |
T1553 |
compound |
Acdp,proteins |
R881 |
T1553 |
T1551 |
pobj |
proteins,of |
R882 |
T1554 |
T1549 |
prep |
in,importance |
R883 |
T1555 |
T1556 |
amod |
fundamental,processes |
R884 |
T1556 |
T1554 |
pobj |
processes,in |
R885 |
T1557 |
T1556 |
amod |
biological,processes |
R886 |
T1558 |
T1541 |
prep |
in,taken |
R887 |
T1559 |
T1558 |
pobj |
addition,in |
R888 |
T1560 |
T1559 |
prep |
to,addition |
R889 |
T1561 |
T1562 |
det |
the,conservation |
R890 |
T1562 |
T1560 |
pobj |
conservation,to |
R891 |
T1563 |
T1562 |
compound |
sequence,conservation |
R892 |
T1564 |
T1562 |
prep |
in,conservation |
R893 |
T1565 |
T1566 |
advmod |
evolutionarily,divergent |
R894 |
T1566 |
T1567 |
amod |
divergent,species |
R895 |
T1567 |
T1564 |
pobj |
species,in |
R896 |
T1568 |
T1541 |
punct |
.,taken |
R897 |
T1609 |
T1610 |
amod |
Chromosomal,location |
R898 |
T1612 |
T1613 |
compound |
Radiation,mapping |
R899 |
T1613 |
T1615 |
nsubj |
mapping,indicated |
R900 |
T1614 |
T1613 |
compound |
hybrid,mapping |
R901 |
T1616 |
T1617 |
mark |
that,maps |
R902 |
T1617 |
T1615 |
ccomp |
maps,indicated |
R903 |
T1618 |
T1619 |
det |
the,gene |
R904 |
T1619 |
T1617 |
nsubj |
gene,maps |
R905 |
T1620 |
T1619 |
compound |
Acdp1,gene |
R906 |
T1621 |
T1617 |
prep |
to,maps |
R907 |
T1622 |
T1621 |
pobj |
chromosome,to |
R908 |
T1623 |
T1622 |
nummod |
19,chromosome |
R909 |
T1624 |
T1617 |
prep |
between,maps |
R910 |
T1625 |
T1626 |
compound |
markers,D19Mit119 |
R911 |
T1626 |
T1624 |
pobj |
D19Mit119,between |
R912 |
T1627 |
T1628 |
punct |
(,cR |
R913 |
T1628 |
T1626 |
parataxis |
cR,D19Mit119 |
R914 |
T1629 |
T1628 |
nummod |
34.3,cR |
R915 |
T1630 |
T1628 |
amod |
proximal,cR |
R916 |
T1631 |
T1628 |
punct |
),cR |
R917 |
T1632 |
T1626 |
cc |
and,D19Mit119 |
R918 |
T1633 |
T1626 |
conj |
D19Mit112,D19Mit119 |
R919 |
T1634 |
T1635 |
punct |
(,cR |
R920 |
T1635 |
T1633 |
parataxis |
cR,D19Mit112 |
R921 |
T1636 |
T1635 |
nummod |
13.6,cR |
R922 |
T1637 |
T1635 |
amod |
distal,cR |
R923 |
T1638 |
T1635 |
punct |
),cR |
R924 |
T1639 |
T1615 |
punct |
.,indicated |
R925 |
T1641 |
T1642 |
det |
The,gene |
R926 |
T1642 |
T1644 |
nsubj |
gene,maps |
R927 |
T1643 |
T1642 |
compound |
Acdp2,gene |
R928 |
T1645 |
T1646 |
advmod |
slightly,more |
R929 |
T1646 |
T1647 |
advmod |
more,distal |
R930 |
T1647 |
T1644 |
advcl |
distal,maps |
R931 |
T1648 |
T1644 |
prep |
to,maps |
R932 |
T1649 |
T1650 |
det |
the,Acdp1 |
R933 |
T1650 |
T1648 |
pobj |
Acdp1,to |
R934 |
T1651 |
T1650 |
prep |
on,Acdp1 |
R935 |
T1652 |
T1651 |
pobj |
chromosome,on |
R936 |
T1653 |
T1652 |
nummod |
19,chromosome |
R937 |
T1654 |
T1644 |
prep |
between,maps |
R938 |
T1655 |
T1654 |
pobj |
D19Mit9,between |
R939 |
T1656 |
T1657 |
punct |
(,cR |
R940 |
T1657 |
T1655 |
parataxis |
cR,D19Mit9 |
R941 |
T1658 |
T1657 |
nummod |
2.4,cR |
R942 |
T1659 |
T1657 |
amod |
proximal,cR |
R943 |
T1660 |
T1657 |
punct |
),cR |
R944 |
T1661 |
T1655 |
cc |
and,D19Mit9 |
R945 |
T1662 |
T1655 |
conj |
D19Mit38,D19Mit9 |
R946 |
T1663 |
T1664 |
punct |
(,cR |
R947 |
T1664 |
T1662 |
parataxis |
cR,D19Mit38 |
R948 |
T1665 |
T1664 |
nummod |
15.1,cR |
R949 |
T1666 |
T1664 |
amod |
distal,cR |
R950 |
T1667 |
T1664 |
punct |
),cR |
R951 |
T1668 |
T1644 |
punct |
.,maps |
R952 |
T1670 |
T1671 |
det |
The,genes |
R953 |
T1671 |
T1675 |
nsubj |
genes,map |
R954 |
T1672 |
T1671 |
nmod |
Acdp3,genes |
R955 |
T1673 |
T1672 |
cc |
and,Acdp3 |
R956 |
T1674 |
T1672 |
conj |
Acdp4,Acdp3 |
R957 |
T1676 |
T1675 |
prep |
to,map |
R958 |
T1677 |
T1676 |
pobj |
chromosome,to |
R959 |
T1678 |
T1677 |
nummod |
1,chromosome |
R960 |
T1679 |
T1675 |
prep |
within,map |
R961 |
T1680 |
T1681 |
nummod |
one,clone |
R962 |
T1681 |
T1679 |
pobj |
clone,within |
R963 |
T1682 |
T1681 |
compound |
BAC,clone |
R964 |
T1683 |
T1684 |
punct |
(,294I17 |
R965 |
T1684 |
T1681 |
parataxis |
294I17,clone |
R966 |
T1685 |
T1684 |
compound |
RP23,294I17 |
R967 |
T1686 |
T1684 |
punct |
-,294I17 |
R968 |
T1687 |
T1684 |
punct |
),294I17 |
R969 |
T1688 |
T1681 |
punct |
", ",clone |
R970 |
T1689 |
T1681 |
amod |
proximal,clone |
R971 |
T1690 |
T1689 |
prep |
to,proximal |
R972 |
T1691 |
T1692 |
compound |
marker,D1Mit171 |
R973 |
T1692 |
T1690 |
pobj |
D1Mit171,to |
R974 |
T1693 |
T1694 |
punct |
(,cR |
R975 |
T1694 |
T1692 |
parataxis |
cR,D1Mit171 |
R976 |
T1695 |
T1694 |
nummod |
17.4,cR |
R977 |
T1696 |
T1694 |
punct |
),cR |
R978 |
T1697 |
T1675 |
punct |
.,map |
R979 |
T1699 |
T1700 |
det |
These,regions |
R980 |
T1700 |
T1701 |
nsubj |
regions,are |
R981 |
T1702 |
T1701 |
acomp |
syntenic,are |
R982 |
T1703 |
T1702 |
prep |
to,syntenic |
R983 |
T1704 |
T1705 |
det |
the,counterparts |
R984 |
T1705 |
T1703 |
pobj |
counterparts,to |
R985 |
T1706 |
T1705 |
amod |
human,counterparts |
R986 |
T1707 |
T1701 |
punct |
.,are |
R987 |
T2019 |
T2020 |
compound |
Sequence,homology |
R988 |
T2021 |
T2020 |
cc |
and,homology |
R989 |
T2022 |
T2023 |
amod |
molecular,characteristics |
R990 |
T2023 |
T2020 |
conj |
characteristics,homology |
R991 |
T2025 |
T2026 |
det |
The,genes |
R992 |
T2026 |
T2029 |
nsubj |
genes,showed |
R993 |
T2027 |
T2026 |
compound |
mouse,genes |
R994 |
T2028 |
T2026 |
compound |
Acdp,genes |
R995 |
T2030 |
T2031 |
advmod |
very,strong |
R996 |
T2031 |
T2032 |
amod |
strong,homologies |
R997 |
T2032 |
T2029 |
dobj |
homologies,showed |
R998 |
T2033 |
T2032 |
prep |
of,homologies |
R999 |
T2034 |
T2035 |
preconj |
both,nucleotide |