Id |
Subject |
Object |
Predicate |
Lexical cue |
T216 |
0-9 |
JJ |
denotes |
Molecular |
T218 |
0-68 |
sentence |
denotes |
Molecular cloning and characterization of the mouse Acdp gene family |
T217 |
10-17 |
NN |
denotes |
cloning |
T219 |
18-21 |
CC |
denotes |
and |
T220 |
22-38 |
NN |
denotes |
characterization |
T221 |
39-41 |
IN |
denotes |
of |
T222 |
42-45 |
DT |
denotes |
the |
T224 |
46-51 |
NN |
denotes |
mouse |
T225 |
52-56 |
NN |
denotes |
Acdp |
T226 |
57-61 |
NN |
denotes |
gene |
T223 |
62-68 |
NN |
denotes |
family |
T227 |
68-69 |
sentence |
denotes |
|
T228 |
79-89 |
sentence |
denotes |
Background |
T229 |
79-89 |
NN |
denotes |
Background |
T230 |
89-208 |
sentence |
denotes |
We have recently cloned and characterized a novel gene family named ancient conserved domain protein (ACDP) in humans. |
T231 |
90-92 |
PRP |
denotes |
We |
T233 |
93-97 |
VBP |
denotes |
have |
T234 |
98-106 |
RB |
denotes |
recently |
T232 |
107-113 |
VBN |
denotes |
cloned |
T235 |
114-117 |
CC |
denotes |
and |
T236 |
118-131 |
VBN |
denotes |
characterized |
T237 |
132-133 |
DT |
denotes |
a |
T239 |
134-139 |
JJ |
denotes |
novel |
T240 |
140-144 |
NN |
denotes |
gene |
T238 |
145-151 |
NN |
denotes |
family |
T241 |
152-157 |
VBN |
denotes |
named |
T242 |
158-165 |
JJ |
denotes |
ancient |
T244 |
166-175 |
VBN |
denotes |
conserved |
T245 |
176-182 |
NN |
denotes |
domain |
T243 |
183-190 |
NN |
denotes |
protein |
T246 |
191-192 |
-LRB- |
denotes |
( |
T247 |
192-196 |
NN |
denotes |
ACDP |
T248 |
196-197 |
-RRB- |
denotes |
) |
T249 |
198-200 |
IN |
denotes |
in |
T250 |
201-207 |
NNS |
denotes |
humans |
T251 |
207-208 |
. |
denotes |
. |
T252 |
208-360 |
sentence |
denotes |
To facilitate the functional study of this novel gene family, we have cloned and characterized Acdp, the mouse homologue of the human ACDP gene family. |
T253 |
209-211 |
TO |
denotes |
To |
T254 |
212-222 |
VB |
denotes |
facilitate |
T256 |
223-226 |
DT |
denotes |
the |
T258 |
227-237 |
JJ |
denotes |
functional |
T257 |
238-243 |
NN |
denotes |
study |
T259 |
244-246 |
IN |
denotes |
of |
T260 |
247-251 |
DT |
denotes |
this |
T262 |
252-257 |
JJ |
denotes |
novel |
T263 |
258-262 |
NN |
denotes |
gene |
T261 |
263-269 |
NN |
denotes |
family |
T264 |
269-271 |
, |
denotes |
, |
T265 |
271-273 |
PRP |
denotes |
we |
T266 |
274-278 |
VBP |
denotes |
have |
T255 |
279-285 |
VBN |
denotes |
cloned |
T267 |
286-289 |
CC |
denotes |
and |
T268 |
290-303 |
VBN |
denotes |
characterized |
T269 |
304-308 |
NN |
denotes |
Acdp |
T270 |
308-310 |
, |
denotes |
, |
T271 |
310-313 |
DT |
denotes |
the |
T273 |
314-319 |
NN |
denotes |
mouse |
T272 |
320-329 |
NN |
denotes |
homologue |
T274 |
330-332 |
IN |
denotes |
of |
T275 |
333-336 |
DT |
denotes |
the |
T277 |
337-342 |
JJ |
denotes |
human |
T278 |
343-347 |
NN |
denotes |
ACDP |
T279 |
348-352 |
NN |
denotes |
gene |
T276 |
353-359 |
NN |
denotes |
family |
T280 |
359-360 |
. |
denotes |
. |
T281 |
360-369 |
sentence |
denotes |
Results |
T282 |
362-369 |
NNS |
denotes |
Results |
T283 |
369-570 |
sentence |
denotes |
The four Acdp genes (Acdp1, Acdp2, Acdp3 and Acdp4) contain 3,631 bp, 3,244 bp, 2,684 bp and 2,743 bp of cDNA sequences, and encode deduced proteins of 951, 874, 713 and 771 amino acids, respectively. |
T284 |
370-373 |
DT |
denotes |
The |
T286 |
374-378 |
CD |
denotes |
four |
T287 |
379-383 |
NN |
denotes |
Acdp |
T285 |
384-389 |
NNS |
denotes |
genes |
T289 |
390-391 |
-LRB- |
denotes |
( |
T290 |
391-396 |
NN |
denotes |
Acdp1 |
T291 |
396-398 |
, |
denotes |
, |
T292 |
398-403 |
NN |
denotes |
Acdp2 |
T293 |
403-405 |
, |
denotes |
, |
T294 |
405-410 |
NN |
denotes |
Acdp3 |
T295 |
411-414 |
CC |
denotes |
and |
T296 |
415-420 |
NN |
denotes |
Acdp4 |
T297 |
420-421 |
-RRB- |
denotes |
) |
T288 |
422-429 |
VBP |
denotes |
contain |
T298 |
430-435 |
CD |
denotes |
3,631 |
T299 |
436-438 |
NNS |
denotes |
bp |
T300 |
438-440 |
, |
denotes |
, |
T301 |
440-445 |
CD |
denotes |
3,244 |
T302 |
446-448 |
NNS |
denotes |
bp |
T303 |
448-450 |
, |
denotes |
, |
T304 |
450-455 |
CD |
denotes |
2,684 |
T305 |
456-458 |
NNS |
denotes |
bp |
T306 |
459-462 |
CC |
denotes |
and |
T307 |
463-468 |
CD |
denotes |
2,743 |
T308 |
469-471 |
NNS |
denotes |
bp |
T309 |
472-474 |
IN |
denotes |
of |
T310 |
475-479 |
NN |
denotes |
cDNA |
T311 |
480-489 |
NNS |
denotes |
sequences |
T312 |
489-491 |
, |
denotes |
, |
T313 |
491-494 |
CC |
denotes |
and |
T314 |
495-501 |
VBP |
denotes |
encode |
T315 |
502-509 |
VBN |
denotes |
deduced |
T316 |
510-518 |
NN |
denotes |
proteins |
T317 |
519-521 |
IN |
denotes |
of |
T318 |
522-525 |
CD |
denotes |
951 |
T320 |
525-527 |
, |
denotes |
, |
T321 |
527-530 |
CD |
denotes |
874 |
T322 |
530-532 |
, |
denotes |
, |
T323 |
532-535 |
CD |
denotes |
713 |
T324 |
536-539 |
CC |
denotes |
and |
T325 |
540-543 |
CD |
denotes |
771 |
T326 |
544-549 |
NN |
denotes |
amino |
T319 |
550-555 |
NNS |
denotes |
acids |
T327 |
555-557 |
, |
denotes |
, |
T328 |
557-569 |
RB |
denotes |
respectively |
T329 |
569-570 |
. |
denotes |
. |
T330 |
570-701 |
sentence |
denotes |
The mouse Acdp genes showed very strong homologies (>90%) in both nucleotide and amino acid sequences to their human counterparts. |
T331 |
571-574 |
DT |
denotes |
The |
T333 |
575-580 |
NN |
denotes |
mouse |
T334 |
581-585 |
NN |
denotes |
Acdp |
T332 |
586-591 |
NNS |
denotes |
genes |
T335 |
592-598 |
VBD |
denotes |
showed |
T336 |
599-603 |
RB |
denotes |
very |
T337 |
604-610 |
JJ |
denotes |
strong |
T338 |
611-621 |
NNS |
denotes |
homologies |
T339 |
622-623 |
-LRB- |
denotes |
( |
T341 |
623-624 |
SYM |
denotes |
> |
T342 |
624-626 |
CD |
denotes |
90 |
T340 |
626-627 |
NN |
denotes |
% |
T343 |
627-628 |
-RRB- |
denotes |
) |
T344 |
629-631 |
IN |
denotes |
in |
T345 |
632-636 |
CC |
denotes |
both |
T346 |
637-647 |
NN |
denotes |
nucleotide |
T348 |
648-651 |
CC |
denotes |
and |
T349 |
652-657 |
NN |
denotes |
amino |
T350 |
658-662 |
NN |
denotes |
acid |
T347 |
663-672 |
NNS |
denotes |
sequences |
T351 |
673-675 |
IN |
denotes |
to |
T352 |
676-681 |
PRP$ |
denotes |
their |
T354 |
682-687 |
JJ |
denotes |
human |
T353 |
688-700 |
NNS |
denotes |
counterparts |
T355 |
700-701 |
. |
denotes |
. |
T356 |
701-855 |
sentence |
denotes |
In addition, both nucleotide and amino acid sequences within the Ancient Conserved Domain (ACD) are highly conserved in many different taxonomic species. |
T357 |
702-704 |
IN |
denotes |
In |
T359 |
705-713 |
NN |
denotes |
addition |
T360 |
713-715 |
, |
denotes |
, |
T361 |
715-719 |
CC |
denotes |
both |
T362 |
720-730 |
NN |
denotes |
nucleotide |
T364 |
731-734 |
CC |
denotes |
and |
T365 |
735-740 |
NN |
denotes |
amino |
T366 |
741-745 |
NN |
denotes |
acid |
T363 |
746-755 |
NNS |
denotes |
sequences |
T367 |
756-762 |
IN |
denotes |
within |
T368 |
763-766 |
DT |
denotes |
the |
T370 |
767-774 |
JJ |
denotes |
Ancient |
T371 |
775-784 |
VBN |
denotes |
Conserved |
T369 |
785-791 |
NN |
denotes |
Domain |
T372 |
792-793 |
-LRB- |
denotes |
( |
T373 |
793-796 |
NN |
denotes |
ACD |
T374 |
796-797 |
-RRB- |
denotes |
) |
T375 |
798-801 |
VBP |
denotes |
are |
T376 |
802-808 |
RB |
denotes |
highly |
T358 |
809-818 |
VBN |
denotes |
conserved |
T377 |
819-821 |
IN |
denotes |
in |
T378 |
822-826 |
JJ |
denotes |
many |
T380 |
827-836 |
JJ |
denotes |
different |
T381 |
837-846 |
JJ |
denotes |
taxonomic |
T379 |
847-854 |
NNS |
denotes |
species |
T382 |
854-855 |
. |
denotes |
. |
T383 |
855-1032 |
sentence |
denotes |
Particularly, Acdp proteins showed very strong AA homologies to the bacteria CorC protein (35% AA identity with 55% homology), which is involved in magnesium and cobalt efflux. |
T384 |
856-868 |
RB |
denotes |
Particularly |
T386 |
868-870 |
, |
denotes |
, |
T387 |
870-874 |
NN |
denotes |
Acdp |
T388 |
875-883 |
NN |
denotes |
proteins |
T385 |
884-890 |
VBD |
denotes |
showed |
T389 |
891-895 |
RB |
denotes |
very |
T390 |
896-902 |
JJ |
denotes |
strong |
T392 |
903-905 |
NN |
denotes |
AA |
T391 |
906-916 |
NNS |
denotes |
homologies |
T393 |
917-919 |
IN |
denotes |
to |
T394 |
920-923 |
DT |
denotes |
the |
T396 |
924-932 |
NNS |
denotes |
bacteria |
T397 |
933-937 |
NN |
denotes |
CorC |
T395 |
938-945 |
NN |
denotes |
protein |
T398 |
946-947 |
-LRB- |
denotes |
( |
T400 |
947-949 |
CD |
denotes |
35 |
T401 |
949-950 |
NN |
denotes |
% |
T402 |
951-953 |
NN |
denotes |
AA |
T399 |
954-962 |
NN |
denotes |
identity |
T403 |
963-967 |
IN |
denotes |
with |
T404 |
968-970 |
CD |
denotes |
55 |
T405 |
970-971 |
NN |
denotes |
% |
T406 |
972-980 |
NN |
denotes |
homology |
T407 |
980-981 |
-RRB- |
denotes |
) |
T408 |
981-983 |
, |
denotes |
, |
T409 |
983-988 |
WDT |
denotes |
which |
T411 |
989-991 |
VBZ |
denotes |
is |
T410 |
992-1000 |
VBN |
denotes |
involved |
T412 |
1001-1003 |
IN |
denotes |
in |
T413 |
1004-1013 |
NN |
denotes |
magnesium |
T415 |
1014-1017 |
CC |
denotes |
and |
T416 |
1018-1024 |
NN |
denotes |
cobalt |
T414 |
1025-1031 |
NN |
denotes |
efflux |
T417 |
1031-1032 |
. |
denotes |
. |
T418 |
1032-1204 |
sentence |
denotes |
The Acdp genes are widely expressed in all tissues tested except for Acdp1, which is only highly expressed in the brain with low levels of expression in kidney and testis. |
T419 |
1033-1036 |
DT |
denotes |
The |
T421 |
1037-1041 |
NN |
denotes |
Acdp |
T420 |
1042-1047 |
NNS |
denotes |
genes |
T423 |
1048-1051 |
VBP |
denotes |
are |
T424 |
1052-1058 |
RB |
denotes |
widely |
T422 |
1059-1068 |
VBN |
denotes |
expressed |
T425 |
1069-1071 |
IN |
denotes |
in |
T426 |
1072-1075 |
DT |
denotes |
all |
T427 |
1076-1083 |
NNS |
denotes |
tissues |
T428 |
1084-1090 |
VBN |
denotes |
tested |
T429 |
1091-1097 |
IN |
denotes |
except |
T430 |
1098-1101 |
IN |
denotes |
for |
T431 |
1102-1107 |
NN |
denotes |
Acdp1 |
T432 |
1107-1109 |
, |
denotes |
, |
T433 |
1109-1114 |
WDT |
denotes |
which |
T435 |
1115-1117 |
VBZ |
denotes |
is |
T436 |
1118-1122 |
RB |
denotes |
only |
T437 |
1123-1129 |
RB |
denotes |
highly |
T434 |
1130-1139 |
VBN |
denotes |
expressed |
T438 |
1140-1142 |
IN |
denotes |
in |
T439 |
1143-1146 |
DT |
denotes |
the |
T440 |
1147-1152 |
NN |
denotes |
brain |
T441 |
1153-1157 |
IN |
denotes |
with |
T443 |
1158-1161 |
JJ |
denotes |
low |
T442 |
1162-1168 |
NNS |
denotes |
levels |
T444 |
1169-1171 |
IN |
denotes |
of |
T445 |
1172-1182 |
NN |
denotes |
expression |
T446 |
1183-1185 |
IN |
denotes |
in |
T447 |
1186-1192 |
NN |
denotes |
kidney |
T448 |
1193-1196 |
CC |
denotes |
and |
T449 |
1197-1203 |
NN |
denotes |
testis |
T450 |
1203-1204 |
. |
denotes |
. |
T451 |
1204-1311 |
sentence |
denotes |
Immunostaining of Acdp1 in hippocampus neurons revealed a predominant localization on the plasma membrane. |
T452 |
1205-1219 |
NN |
denotes |
Immunostaining |
T454 |
1220-1222 |
IN |
denotes |
of |
T455 |
1223-1228 |
NN |
denotes |
Acdp1 |
T456 |
1229-1231 |
IN |
denotes |
in |
T457 |
1232-1243 |
NN |
denotes |
hippocampus |
T458 |
1244-1251 |
NNS |
denotes |
neurons |
T453 |
1252-1260 |
VBD |
denotes |
revealed |
T459 |
1261-1262 |
DT |
denotes |
a |
T461 |
1263-1274 |
JJ |
denotes |
predominant |
T460 |
1275-1287 |
NN |
denotes |
localization |
T462 |
1288-1290 |
IN |
denotes |
on |
T463 |
1291-1294 |
DT |
denotes |
the |
T465 |
1295-1301 |
NN |
denotes |
plasma |
T464 |
1302-1310 |
NN |
denotes |
membrane |
T466 |
1310-1311 |
. |
denotes |
. |
T467 |
1311-1323 |
sentence |
denotes |
Conclusion |
T468 |
1313-1323 |
NN |
denotes |
Conclusion |
T469 |
1323-1501 |
sentence |
denotes |
The Acdp genes are evolutionarily conserved in diverse species and ubiquitously expressed throughout development and adult tissues suggesting that Acdp may be an essential gene. |
T470 |
1324-1327 |
DT |
denotes |
The |
T472 |
1328-1332 |
NN |
denotes |
Acdp |
T471 |
1333-1338 |
NNS |
denotes |
genes |
T474 |
1339-1342 |
VBP |
denotes |
are |
T475 |
1343-1357 |
RB |
denotes |
evolutionarily |
T473 |
1358-1367 |
VBN |
denotes |
conserved |
T476 |
1368-1370 |
IN |
denotes |
in |
T477 |
1371-1378 |
JJ |
denotes |
diverse |
T478 |
1379-1386 |
NNS |
denotes |
species |
T479 |
1387-1390 |
CC |
denotes |
and |
T480 |
1391-1403 |
RB |
denotes |
ubiquitously |
T481 |
1404-1413 |
VBN |
denotes |
expressed |
T482 |
1414-1424 |
IN |
denotes |
throughout |
T483 |
1425-1436 |
NN |
denotes |
development |
T484 |
1437-1440 |
CC |
denotes |
and |
T485 |
1441-1446 |
JJ |
denotes |
adult |
T486 |
1447-1454 |
NNS |
denotes |
tissues |
T487 |
1455-1465 |
VBG |
denotes |
suggesting |
T488 |
1466-1470 |
IN |
denotes |
that |
T490 |
1471-1475 |
NN |
denotes |
Acdp |
T491 |
1476-1479 |
MD |
denotes |
may |
T489 |
1480-1482 |
VB |
denotes |
be |
T492 |
1483-1485 |
DT |
denotes |
an |
T494 |
1486-1495 |
JJ |
denotes |
essential |
T493 |
1496-1500 |
NN |
denotes |
gene |
T495 |
1500-1501 |
. |
denotes |
. |
T496 |
1501-1606 |
sentence |
denotes |
Acdp showed strong homology to bacteria CorC protein and predominantly localized on the plasma membrane. |
T497 |
1502-1506 |
NN |
denotes |
Acdp |
T498 |
1507-1513 |
VBD |
denotes |
showed |
T499 |
1514-1520 |
JJ |
denotes |
strong |
T500 |
1521-1529 |
NN |
denotes |
homology |
T501 |
1530-1532 |
IN |
denotes |
to |
T502 |
1533-1541 |
NNS |
denotes |
bacteria |
T504 |
1542-1546 |
NN |
denotes |
CorC |
T503 |
1547-1554 |
NN |
denotes |
protein |
T505 |
1555-1558 |
CC |
denotes |
and |
T506 |
1559-1572 |
RB |
denotes |
predominantly |
T507 |
1573-1582 |
VBD |
denotes |
localized |
T508 |
1583-1585 |
IN |
denotes |
on |
T509 |
1586-1589 |
DT |
denotes |
the |
T511 |
1590-1596 |
NN |
denotes |
plasma |
T510 |
1597-1605 |
NN |
denotes |
membrane |
T512 |
1605-1606 |
. |
denotes |
. |
T513 |
1606-1716 |
sentence |
denotes |
These results suggest that Acdp is probably a family of proteins involved in ion transport in mammalian cells |
T514 |
1607-1612 |
DT |
denotes |
These |
T515 |
1613-1620 |
NNS |
denotes |
results |
T516 |
1621-1628 |
VBP |
denotes |
suggest |
T517 |
1629-1633 |
IN |
denotes |
that |
T519 |
1634-1638 |
NN |
denotes |
Acdp |
T518 |
1639-1641 |
VBZ |
denotes |
is |
T520 |
1642-1650 |
RB |
denotes |
probably |
T521 |
1651-1652 |
DT |
denotes |
a |
T522 |
1653-1659 |
NN |
denotes |
family |
T523 |
1660-1662 |
IN |
denotes |
of |
T524 |
1663-1671 |
NN |
denotes |
proteins |
T525 |
1672-1680 |
VBN |
denotes |
involved |
T526 |
1681-1683 |
IN |
denotes |
in |
T527 |
1684-1687 |
NN |
denotes |
ion |
T528 |
1688-1697 |
NN |
denotes |
transport |
T529 |
1698-1700 |
IN |
denotes |
in |
T530 |
1701-1710 |
JJ |
denotes |
mammalian |
T531 |
1711-1716 |
NNS |
denotes |
cells |
T593 |
1729-1731 |
PRP |
denotes |
We |
T595 |
1732-1736 |
VBP |
denotes |
have |
T596 |
1737-1745 |
RB |
denotes |
recently |
T594 |
1746-1752 |
VBN |
denotes |
cloned |
T597 |
1753-1756 |
CC |
denotes |
and |
T598 |
1757-1770 |
VBN |
denotes |
characterized |
T599 |
1771-1772 |
DT |
denotes |
a |
T601 |
1773-1778 |
JJ |
denotes |
novel |
T602 |
1779-1783 |
NN |
denotes |
gene |
T600 |
1784-1790 |
NN |
denotes |
family |
T603 |
1791-1796 |
VBN |
denotes |
named |
T604 |
1797-1804 |
JJ |
denotes |
ancient |
T606 |
1805-1814 |
VBN |
denotes |
conserved |
T607 |
1815-1821 |
NN |
denotes |
domain |
T605 |
1822-1829 |
NN |
denotes |
protein |
T608 |
1830-1831 |
-LRB- |
denotes |
( |
T609 |
1831-1835 |
NN |
denotes |
ACDP |
T610 |
1835-1836 |
-RRB- |
denotes |
) |
T611 |
1837-1842 |
WDT |
denotes |
which |
T612 |
1843-1850 |
VBZ |
denotes |
encodes |
T613 |
1851-1855 |
CD |
denotes |
four |
T615 |
1856-1863 |
NN |
denotes |
protein |
T614 |
1864-1871 |
NNS |
denotes |
members |
T616 |
1872-1874 |
IN |
denotes |
in |
T617 |
1875-1881 |
NNS |
denotes |
humans |
T618 |
1882-1883 |
-LRB- |
denotes |
[ |
T619 |
1883-1884 |
CD |
denotes |
1 |
T620 |
1884-1885 |
-RRB- |
denotes |
] |
T621 |
1885-1886 |
. |
denotes |
. |
T622 |
1886-2038 |
sentence |
denotes |
We found that this gene family is evolutionarily conserved in diverse species ranging from bacteria, yeast, C. elegans, and D. melanogaster to mammals. |
T623 |
1887-1889 |
PRP |
denotes |
We |
T624 |
1890-1895 |
VBD |
denotes |
found |
T625 |
1896-1900 |
IN |
denotes |
that |
T627 |
1901-1905 |
DT |
denotes |
this |
T629 |
1906-1910 |
NN |
denotes |
gene |
T628 |
1911-1917 |
NN |
denotes |
family |
T626 |
1918-1920 |
VBZ |
denotes |
is |
T630 |
1921-1935 |
RB |
denotes |
evolutionarily |
T631 |
1936-1945 |
JJ |
denotes |
conserved |
T632 |
1946-1948 |
IN |
denotes |
in |
T633 |
1949-1956 |
JJ |
denotes |
diverse |
T634 |
1957-1964 |
NNS |
denotes |
species |
T635 |
1965-1972 |
VBG |
denotes |
ranging |
T636 |
1973-1977 |
IN |
denotes |
from |
T637 |
1978-1986 |
NNS |
denotes |
bacteria |
T638 |
1986-1988 |
, |
denotes |
, |
T639 |
1988-1993 |
NN |
denotes |
yeast |
T640 |
1993-1995 |
, |
denotes |
, |
T641 |
1995-1997 |
NNP |
denotes |
C. |
T642 |
1998-2005 |
NNP |
denotes |
elegans |
T643 |
2005-2007 |
, |
denotes |
, |
T644 |
2007-2010 |
CC |
denotes |
and |
T645 |
2011-2013 |
NNP |
denotes |
D. |
T646 |
2014-2026 |
NNP |
denotes |
melanogaster |
T647 |
2027-2029 |
IN |
denotes |
to |
T648 |
2030-2037 |
NNS |
denotes |
mammals |
T649 |
2037-2038 |
. |
denotes |
. |
T650 |
2038-2177 |
sentence |
denotes |
The sequence conservation and the presence of multiple members within a species may imply functional importance associated with the genes. |
T651 |
2039-2042 |
DT |
denotes |
The |
T653 |
2043-2051 |
NN |
denotes |
sequence |
T652 |
2052-2064 |
NN |
denotes |
conservation |
T655 |
2065-2068 |
CC |
denotes |
and |
T656 |
2069-2072 |
DT |
denotes |
the |
T657 |
2073-2081 |
NN |
denotes |
presence |
T658 |
2082-2084 |
IN |
denotes |
of |
T659 |
2085-2093 |
JJ |
denotes |
multiple |
T660 |
2094-2101 |
NNS |
denotes |
members |
T661 |
2102-2108 |
IN |
denotes |
within |
T662 |
2109-2110 |
DT |
denotes |
a |
T663 |
2111-2118 |
NN |
denotes |
species |
T664 |
2119-2122 |
MD |
denotes |
may |
T654 |
2123-2128 |
VB |
denotes |
imply |
T665 |
2129-2139 |
JJ |
denotes |
functional |
T666 |
2140-2150 |
NN |
denotes |
importance |
T667 |
2151-2161 |
VBN |
denotes |
associated |
T668 |
2162-2166 |
IN |
denotes |
with |
T669 |
2167-2170 |
DT |
denotes |
the |
T670 |
2171-2176 |
NNS |
denotes |
genes |
T671 |
2176-2177 |
. |
denotes |
. |
T672 |
2177-2325 |
sentence |
denotes |
To facilitate the functional analysis of the ACDP gene family, we cloned and characterized Acdp, the mouse homologue of the human ACDP gene family. |
T673 |
2178-2180 |
TO |
denotes |
To |
T674 |
2181-2191 |
VB |
denotes |
facilitate |
T676 |
2192-2195 |
DT |
denotes |
the |
T678 |
2196-2206 |
JJ |
denotes |
functional |
T677 |
2207-2215 |
NN |
denotes |
analysis |
T679 |
2216-2218 |
IN |
denotes |
of |
T680 |
2219-2222 |
DT |
denotes |
the |
T682 |
2223-2227 |
NN |
denotes |
ACDP |
T683 |
2228-2232 |
NN |
denotes |
gene |
T681 |
2233-2239 |
NN |
denotes |
family |
T684 |
2239-2241 |
, |
denotes |
, |
T685 |
2241-2243 |
PRP |
denotes |
we |
T675 |
2244-2250 |
VBD |
denotes |
cloned |
T686 |
2251-2254 |
CC |
denotes |
and |
T687 |
2255-2268 |
VBD |
denotes |
characterized |
T688 |
2269-2273 |
NN |
denotes |
Acdp |
T689 |
2273-2275 |
, |
denotes |
, |
T690 |
2275-2278 |
DT |
denotes |
the |
T692 |
2279-2284 |
NN |
denotes |
mouse |
T691 |
2285-2294 |
NN |
denotes |
homologue |
T693 |
2295-2297 |
IN |
denotes |
of |
T694 |
2298-2301 |
DT |
denotes |
the |
T696 |
2302-2307 |
JJ |
denotes |
human |
T697 |
2308-2312 |
NN |
denotes |
ACDP |
T698 |
2313-2317 |
NN |
denotes |
gene |
T695 |
2318-2324 |
NN |
denotes |
family |
T699 |
2324-2325 |
. |
denotes |
. |
T863 |
2336-2345 |
JJ |
denotes |
Molecular |
T864 |
2346-2353 |
NN |
denotes |
cloning |
T865 |
2354-2356 |
IN |
denotes |
of |
T866 |
2357-2360 |
DT |
denotes |
the |
T868 |
2361-2365 |
NN |
denotes |
Acdp |
T869 |
2366-2370 |
NN |
denotes |
gene |
T867 |
2371-2377 |
NN |
denotes |
family |
T870 |
2377-2541 |
sentence |
denotes |
To clone the mouse Acdp genes, the human ACDP cDNA and predicted protein sequences were used to search the mouse EST database with the blastn and tblastn programs. |
T871 |
2378-2380 |
TO |
denotes |
To |
T872 |
2381-2386 |
VB |
denotes |
clone |
T874 |
2387-2390 |
DT |
denotes |
the |
T876 |
2391-2396 |
NN |
denotes |
mouse |
T877 |
2397-2401 |
NN |
denotes |
Acdp |
T875 |
2402-2407 |
NNS |
denotes |
genes |
T878 |
2407-2409 |
, |
denotes |
, |
T879 |
2409-2412 |
DT |
denotes |
the |
T881 |
2413-2418 |
JJ |
denotes |
human |
T882 |
2419-2423 |
NN |
denotes |
ACDP |
T880 |
2424-2428 |
NN |
denotes |
cDNA |
T883 |
2429-2432 |
CC |
denotes |
and |
T884 |
2433-2442 |
JJ |
denotes |
predicted |
T886 |
2443-2450 |
NN |
denotes |
protein |
T885 |
2451-2460 |
NNS |
denotes |
sequences |
T887 |
2461-2465 |
VBD |
denotes |
were |
T873 |
2466-2470 |
VBN |
denotes |
used |
T888 |
2471-2473 |
TO |
denotes |
to |
T889 |
2474-2480 |
VB |
denotes |
search |
T890 |
2481-2484 |
DT |
denotes |
the |
T892 |
2485-2490 |
NN |
denotes |
mouse |
T893 |
2491-2494 |
NN |
denotes |
EST |
T891 |
2495-2503 |
NN |
denotes |
database |
T894 |
2504-2508 |
IN |
denotes |
with |
T895 |
2509-2512 |
DT |
denotes |
the |
T897 |
2513-2519 |
NN |
denotes |
blastn |
T898 |
2520-2523 |
CC |
denotes |
and |
T899 |
2524-2531 |
NN |
denotes |
tblastn |
T896 |
2532-2540 |
NNS |
denotes |
programs |
T900 |
2540-2541 |
. |
denotes |
. |
T901 |
2541-2615 |
sentence |
denotes |
Mouse EST markers corresponding to each Acdp member were then identified. |
T902 |
2542-2547 |
NN |
denotes |
Mouse |
T904 |
2548-2551 |
NN |
denotes |
EST |
T903 |
2552-2559 |
NNS |
denotes |
markers |
T906 |
2560-2573 |
VBG |
denotes |
corresponding |
T907 |
2574-2576 |
IN |
denotes |
to |
T908 |
2577-2581 |
DT |
denotes |
each |
T910 |
2582-2586 |
NN |
denotes |
Acdp |
T909 |
2587-2593 |
NN |
denotes |
member |
T911 |
2594-2598 |
VBD |
denotes |
were |
T912 |
2599-2603 |
RB |
denotes |
then |
T905 |
2604-2614 |
VBN |
denotes |
identified |
T913 |
2614-2615 |
. |
denotes |
. |
T914 |
2615-2729 |
sentence |
denotes |
For example, EST H3086H12-5 corresponds to Acdp1, W98010 for Acdp2, 603299135F1 for Acdp3 and BG083791 for Acdp4. |
T915 |
2616-2619 |
IN |
denotes |
For |
T917 |
2620-2627 |
NN |
denotes |
example |
T918 |
2627-2629 |
, |
denotes |
, |
T919 |
2629-2632 |
NN |
denotes |
EST |
T920 |
2633-2641 |
NN |
denotes |
H3086H12 |
T921 |
2641-2642 |
HYPH |
denotes |
- |
T922 |
2642-2643 |
CD |
denotes |
5 |
T916 |
2644-2655 |
VBZ |
denotes |
corresponds |
T923 |
2656-2658 |
IN |
denotes |
to |
T924 |
2659-2664 |
NN |
denotes |
Acdp1 |
T925 |
2664-2666 |
, |
denotes |
, |
T926 |
2666-2672 |
NN |
denotes |
W98010 |
T927 |
2673-2676 |
IN |
denotes |
for |
T928 |
2677-2682 |
NN |
denotes |
Acdp2 |
T929 |
2682-2684 |
, |
denotes |
, |
T930 |
2684-2695 |
NN |
denotes |
603299135F1 |
T931 |
2696-2699 |
IN |
denotes |
for |
T932 |
2700-2705 |
NN |
denotes |
Acdp3 |
T933 |
2706-2709 |
CC |
denotes |
and |
T934 |
2710-2718 |
NN |
denotes |
BG083791 |
T935 |
2719-2722 |
IN |
denotes |
for |
T936 |
2723-2728 |
NN |
denotes |
Acdp4 |
T937 |
2728-2729 |
. |
denotes |
. |
T938 |
2729-2795 |
sentence |
denotes |
A modified oligo-dT with a M13 tail was used for the RT reaction. |
T939 |
2730-2731 |
DT |
denotes |
A |
T941 |
2732-2740 |
VBN |
denotes |
modified |
T942 |
2741-2746 |
NN |
denotes |
oligo |
T943 |
2746-2747 |
HYPH |
denotes |
- |
T940 |
2747-2749 |
NN |
denotes |
dT |
T945 |
2750-2754 |
IN |
denotes |
with |
T946 |
2755-2756 |
DT |
denotes |
a |
T948 |
2757-2760 |
NN |
denotes |
M13 |
T947 |
2761-2765 |
NN |
denotes |
tail |
T949 |
2766-2769 |
VBD |
denotes |
was |
T944 |
2770-2774 |
VBN |
denotes |
used |
T950 |
2775-2778 |
IN |
denotes |
for |
T951 |
2779-2782 |
DT |
denotes |
the |
T953 |
2783-2785 |
NN |
denotes |
RT |
T952 |
2786-2794 |
NN |
denotes |
reaction |
T954 |
2794-2795 |
. |
denotes |
. |
T955 |
2795-2963 |
sentence |
denotes |
A forward primer from each EST marker and the M13 primer (olig-dT tail) were used to amplify the 3' UTR sequence for each corresponding Acdp gene from the RT products. |
T956 |
2796-2797 |
DT |
denotes |
A |
T958 |
2798-2805 |
JJ |
denotes |
forward |
T957 |
2806-2812 |
NN |
denotes |
primer |
T960 |
2813-2817 |
IN |
denotes |
from |
T961 |
2818-2822 |
DT |
denotes |
each |
T963 |
2823-2826 |
NN |
denotes |
EST |
T962 |
2827-2833 |
NN |
denotes |
marker |
T964 |
2834-2837 |
CC |
denotes |
and |
T965 |
2838-2841 |
DT |
denotes |
the |
T967 |
2842-2845 |
NN |
denotes |
M13 |
T966 |
2846-2852 |
NN |
denotes |
primer |
T968 |
2853-2854 |
-LRB- |
denotes |
( |
T969 |
2854-2858 |
NN |
denotes |
olig |
T971 |
2858-2859 |
HYPH |
denotes |
- |
T970 |
2859-2861 |
NN |
denotes |
dT |
T972 |
2862-2866 |
NN |
denotes |
tail |
T973 |
2866-2867 |
-RRB- |
denotes |
) |
T974 |
2868-2872 |
VBD |
denotes |
were |
T959 |
2873-2877 |
VBN |
denotes |
used |
T975 |
2878-2880 |
TO |
denotes |
to |
T976 |
2881-2888 |
VB |
denotes |
amplify |
T977 |
2889-2892 |
DT |
denotes |
the |
T979 |
2893-2894 |
CD |
denotes |
3 |
T981 |
2894-2895 |
SYM |
denotes |
' |
T980 |
2896-2899 |
NN |
denotes |
UTR |
T978 |
2900-2908 |
NN |
denotes |
sequence |
T982 |
2909-2912 |
IN |
denotes |
for |
T983 |
2913-2917 |
DT |
denotes |
each |
T985 |
2918-2931 |
VBG |
denotes |
corresponding |
T986 |
2932-2936 |
NN |
denotes |
Acdp |
T984 |
2937-2941 |
NN |
denotes |
gene |
T987 |
2942-2946 |
IN |
denotes |
from |
T988 |
2947-2950 |
DT |
denotes |
the |
T990 |
2951-2953 |
NN |
denotes |
RT |
T989 |
2954-2962 |
NNS |
denotes |
products |
T991 |
2962-2963 |
. |
denotes |
. |
T992 |
2963-3096 |
sentence |
denotes |
To obtain 5'-end coding sequences for the Acdp genes, we conducted a series nested PCR with combinations of mouse and human primers. |
T993 |
2964-2966 |
TO |
denotes |
To |
T994 |
2967-2973 |
VB |
denotes |
obtain |
T996 |
2974-2975 |
CD |
denotes |
5 |
T998 |
2975-2976 |
SYM |
denotes |
' |
T999 |
2976-2977 |
HYPH |
denotes |
- |
T997 |
2977-2980 |
NN |
denotes |
end |
T1001 |
2981-2987 |
VBG |
denotes |
coding |
T1000 |
2988-2997 |
NNS |
denotes |
sequences |
T1002 |
2998-3001 |
IN |
denotes |
for |
T1003 |
3002-3005 |
DT |
denotes |
the |
T1005 |
3006-3010 |
NN |
denotes |
Acdp |
T1004 |
3011-3016 |
NNS |
denotes |
genes |
T1006 |
3016-3018 |
, |
denotes |
, |
T1007 |
3018-3020 |
PRP |
denotes |
we |
T995 |
3021-3030 |
VBD |
denotes |
conducted |
T1008 |
3031-3032 |
DT |
denotes |
a |
T1010 |
3033-3039 |
NN |
denotes |
series |
T1011 |
3040-3046 |
VBN |
denotes |
nested |
T1009 |
3047-3050 |
NN |
denotes |
PCR |
T1012 |
3051-3055 |
IN |
denotes |
with |
T1013 |
3056-3068 |
NNS |
denotes |
combinations |
T1014 |
3069-3071 |
IN |
denotes |
of |
T1015 |
3072-3077 |
NN |
denotes |
mouse |
T1017 |
3078-3081 |
CC |
denotes |
and |
T1018 |
3082-3087 |
JJ |
denotes |
human |
T1016 |
3088-3095 |
NNS |
denotes |
primers |
T1019 |
3095-3096 |
. |
denotes |
. |
T1020 |
3096-3205 |
sentence |
denotes |
The 5' UTR sequences were identified by directly sequencing BAC DNA containing the corresponding Acdp genes. |
T1021 |
3097-3100 |
DT |
denotes |
The |
T1023 |
3101-3102 |
CD |
denotes |
5 |
T1024 |
3102-3103 |
SYM |
denotes |
' |
T1025 |
3104-3107 |
NN |
denotes |
UTR |
T1022 |
3108-3117 |
NNS |
denotes |
sequences |
T1027 |
3118-3122 |
VBD |
denotes |
were |
T1026 |
3123-3133 |
VBN |
denotes |
identified |
T1028 |
3134-3136 |
IN |
denotes |
by |
T1029 |
3137-3145 |
RB |
denotes |
directly |
T1030 |
3146-3156 |
VBG |
denotes |
sequencing |
T1031 |
3157-3160 |
NN |
denotes |
BAC |
T1032 |
3161-3164 |
NN |
denotes |
DNA |
T1033 |
3165-3175 |
VBG |
denotes |
containing |
T1034 |
3176-3179 |
DT |
denotes |
the |
T1036 |
3180-3193 |
VBG |
denotes |
corresponding |
T1037 |
3194-3198 |
NN |
denotes |
Acdp |
T1035 |
3199-3204 |
NNS |
denotes |
genes |
T1038 |
3204-3205 |
. |
denotes |
. |
T1039 |
3205-3299 |
sentence |
denotes |
The BAC clones were identified by screening a CITB mouse BAC DNA library (Research Genetics). |
T1040 |
3206-3209 |
DT |
denotes |
The |
T1042 |
3210-3213 |
NN |
denotes |
BAC |
T1041 |
3214-3220 |
NNS |
denotes |
clones |
T1044 |
3221-3225 |
VBD |
denotes |
were |
T1043 |
3226-3236 |
VBN |
denotes |
identified |
T1045 |
3237-3239 |
IN |
denotes |
by |
T1046 |
3240-3249 |
VBG |
denotes |
screening |
T1047 |
3250-3251 |
DT |
denotes |
a |
T1049 |
3252-3256 |
NN |
denotes |
CITB |
T1051 |
3257-3262 |
NN |
denotes |
mouse |
T1052 |
3263-3266 |
NN |
denotes |
BAC |
T1050 |
3267-3270 |
NN |
denotes |
DNA |
T1048 |
3271-3278 |
NN |
denotes |
library |
T1053 |
3279-3280 |
-LRB- |
denotes |
( |
T1055 |
3280-3288 |
NNP |
denotes |
Research |
T1054 |
3289-3297 |
NNP |
denotes |
Genetics |
T1056 |
3297-3298 |
-RRB- |
denotes |
) |
T1057 |
3298-3299 |
. |
denotes |
. |
T1058 |
3299-3374 |
sentence |
denotes |
The 5' UTR sequences obtained from above were further confirmed by RT-PCR. |
T1059 |
3300-3303 |
DT |
denotes |
The |
T1061 |
3304-3305 |
CD |
denotes |
5 |
T1062 |
3305-3306 |
SYM |
denotes |
' |
T1063 |
3307-3310 |
NN |
denotes |
UTR |
T1060 |
3311-3320 |
NNS |
denotes |
sequences |
T1065 |
3321-3329 |
VBN |
denotes |
obtained |
T1066 |
3330-3334 |
IN |
denotes |
from |
T1067 |
3335-3340 |
RB |
denotes |
above |
T1068 |
3341-3345 |
VBD |
denotes |
were |
T1069 |
3346-3353 |
RB |
denotes |
further |
T1064 |
3354-3363 |
VBN |
denotes |
confirmed |
T1070 |
3364-3366 |
IN |
denotes |
by |
T1071 |
3367-3369 |
NN |
denotes |
RT |
T1073 |
3369-3370 |
HYPH |
denotes |
- |
T1072 |
3370-3373 |
NN |
denotes |
PCR |
T1074 |
3373-3374 |
. |
denotes |
. |
T1075 |
3374-3489 |
sentence |
denotes |
The Acdp1 gene contains 3,631 bp of nucleotide sequence and encodes a predicted protein with 951 amino acids (AA). |
T1076 |
3375-3378 |
DT |
denotes |
The |
T1078 |
3379-3384 |
NN |
denotes |
Acdp1 |
T1077 |
3385-3389 |
NN |
denotes |
gene |
T1079 |
3390-3398 |
VBZ |
denotes |
contains |
T1080 |
3399-3404 |
CD |
denotes |
3,631 |
T1081 |
3405-3407 |
NNS |
denotes |
bp |
T1082 |
3408-3410 |
IN |
denotes |
of |
T1083 |
3411-3421 |
NN |
denotes |
nucleotide |
T1084 |
3422-3430 |
NN |
denotes |
sequence |
T1085 |
3431-3434 |
CC |
denotes |
and |
T1086 |
3435-3442 |
VBZ |
denotes |
encodes |
T1087 |
3443-3444 |
DT |
denotes |
a |
T1089 |
3445-3454 |
VBN |
denotes |
predicted |
T1088 |
3455-3462 |
NN |
denotes |
protein |
T1090 |
3463-3467 |
IN |
denotes |
with |
T1091 |
3468-3471 |
CD |
denotes |
951 |
T1093 |
3472-3477 |
NN |
denotes |
amino |
T1092 |
3478-3483 |
NNS |
denotes |
acids |
T1094 |
3484-3485 |
-LRB- |
denotes |
( |
T1095 |
3485-3487 |
NN |
denotes |
AA |
T1096 |
3487-3488 |
-RRB- |
denotes |
) |
T1097 |
3488-3489 |
. |
denotes |
. |
T1098 |
3489-3691 |
sentence |
denotes |
The other three Acdp genes (Acdp2, 3 and 4) contain 3,244 bp, 2,684 bp and 2,743 bp of cDNA sequences, and encode deduced proteins of 874 amino acids, 713 amino acids and 771 amino acids, respectively. |
T1099 |
3490-3493 |
DT |
denotes |
The |
T1101 |
3494-3499 |
JJ |
denotes |
other |
T1102 |
3500-3505 |
CD |
denotes |
three |
T1103 |
3506-3510 |
NN |
denotes |
Acdp |
T1100 |
3511-3516 |
NNS |
denotes |
genes |
T1105 |
3517-3518 |
-LRB- |
denotes |
( |
T1106 |
3518-3523 |
NN |
denotes |
Acdp2 |
T1107 |
3523-3525 |
, |
denotes |
, |
T1108 |
3525-3526 |
CD |
denotes |
3 |
T1109 |
3527-3530 |
CC |
denotes |
and |
T1110 |
3531-3532 |
CD |
denotes |
4 |
T1111 |
3532-3533 |
-RRB- |
denotes |
) |
T1104 |
3534-3541 |
VBP |
denotes |
contain |
T1112 |
3542-3547 |
CD |
denotes |
3,244 |
T1113 |
3548-3550 |
NNS |
denotes |
bp |
T1114 |
3550-3552 |
, |
denotes |
, |
T1115 |
3552-3557 |
CD |
denotes |
2,684 |
T1116 |
3558-3560 |
NNS |
denotes |
bp |
T1117 |
3561-3564 |
CC |
denotes |
and |
T1118 |
3565-3570 |
CD |
denotes |
2,743 |
T1119 |
3571-3573 |
NNS |
denotes |
bp |
T1120 |
3574-3576 |
IN |
denotes |
of |
T1121 |
3577-3581 |
NN |
denotes |
cDNA |
T1122 |
3582-3591 |
NNS |
denotes |
sequences |
T1123 |
3591-3593 |
, |
denotes |
, |
T1124 |
3593-3596 |
CC |
denotes |
and |
T1125 |
3597-3603 |
VBP |
denotes |
encode |
T1126 |
3604-3611 |
VBN |
denotes |
deduced |
T1127 |
3612-3620 |
NN |
denotes |
proteins |
T1128 |
3621-3623 |
IN |
denotes |
of |
T1129 |
3624-3627 |
CD |
denotes |
874 |
T1131 |
3628-3633 |
NN |
denotes |
amino |
T1130 |
3634-3639 |
NNS |
denotes |
acids |
T1132 |
3639-3641 |
, |
denotes |
, |
T1133 |
3641-3644 |
CD |
denotes |
713 |
T1135 |
3645-3650 |
NN |
denotes |
amino |
T1134 |
3651-3656 |
NNS |
denotes |
acids |
T1136 |
3657-3660 |
CC |
denotes |
and |
T1137 |
3661-3664 |
CD |
denotes |
771 |
T1139 |
3665-3670 |
NN |
denotes |
amino |
T1138 |
3671-3676 |
NNS |
denotes |
acids |
T1140 |
3676-3678 |
, |
denotes |
, |
T1141 |
3678-3690 |
RB |
denotes |
respectively |
T1142 |
3690-3691 |
. |
denotes |
. |
T1296 |
3693-3699 |
NN |
denotes |
Tissue |
T1297 |
3700-3712 |
NN |
denotes |
distribution |
T1298 |
3712-3816 |
sentence |
denotes |
Northern blot analyses of the Acdp gene family were carried out using membranes purchased from Origene. |
T1299 |
3713-3721 |
NNP |
denotes |
Northern |
T1300 |
3722-3726 |
NN |
denotes |
blot |
T1301 |
3727-3735 |
NNS |
denotes |
analyses |
T1303 |
3736-3738 |
IN |
denotes |
of |
T1304 |
3739-3742 |
DT |
denotes |
the |
T1306 |
3743-3747 |
NN |
denotes |
Acdp |
T1307 |
3748-3752 |
NN |
denotes |
gene |
T1305 |
3753-3759 |
NN |
denotes |
family |
T1308 |
3760-3764 |
VBD |
denotes |
were |
T1302 |
3765-3772 |
VBN |
denotes |
carried |
T1309 |
3773-3776 |
RP |
denotes |
out |
T1310 |
3777-3782 |
VBG |
denotes |
using |
T1311 |
3783-3792 |
NNS |
denotes |
membranes |
T1312 |
3793-3802 |
VBN |
denotes |
purchased |
T1313 |
3803-3807 |
IN |
denotes |
from |
T1314 |
3808-3815 |
NNP |
denotes |
Origene |
T1315 |
3815-3816 |
. |
denotes |
. |
T1316 |
3816-3881 |
sentence |
denotes |
A total of 12 mouse tissues were included in the study (Fig. 1). |
T1317 |
3817-3818 |
DT |
denotes |
A |
T1318 |
3819-3824 |
NN |
denotes |
total |
T1320 |
3825-3827 |
IN |
denotes |
of |
T1321 |
3828-3830 |
CD |
denotes |
12 |
T1323 |
3831-3836 |
NN |
denotes |
mouse |
T1322 |
3837-3844 |
NNS |
denotes |
tissues |
T1324 |
3845-3849 |
VBD |
denotes |
were |
T1319 |
3850-3858 |
VBN |
denotes |
included |
T1325 |
3859-3861 |
IN |
denotes |
in |
T1326 |
3862-3865 |
DT |
denotes |
the |
T1327 |
3866-3871 |
NN |
denotes |
study |
T1328 |
3872-3873 |
-LRB- |
denotes |
( |
T1329 |
3873-3877 |
NN |
denotes |
Fig. |
T1330 |
3878-3879 |
CD |
denotes |
1 |
T1331 |
3879-3880 |
-RRB- |
denotes |
) |
T1332 |
3880-3881 |
. |
denotes |
. |
T1333 |
3881-4068 |
sentence |
denotes |
Due to sequence homologies between each Acdp member within the conserved domain, probes for Northern bolts were PCR fragments from the last exon and the 3' untranslated region sequences. |
T1334 |
3882-3885 |
IN |
denotes |
Due |
T1336 |
3886-3888 |
IN |
denotes |
to |
T1337 |
3889-3897 |
NN |
denotes |
sequence |
T1338 |
3898-3908 |
NNS |
denotes |
homologies |
T1339 |
3909-3916 |
IN |
denotes |
between |
T1340 |
3917-3921 |
DT |
denotes |
each |
T1342 |
3922-3926 |
NN |
denotes |
Acdp |
T1341 |
3927-3933 |
NN |
denotes |
member |
T1343 |
3934-3940 |
IN |
denotes |
within |
T1344 |
3941-3944 |
DT |
denotes |
the |
T1346 |
3945-3954 |
VBN |
denotes |
conserved |
T1345 |
3955-3961 |
NN |
denotes |
domain |
T1347 |
3961-3963 |
, |
denotes |
, |
T1348 |
3963-3969 |
NNS |
denotes |
probes |
T1349 |
3970-3973 |
IN |
denotes |
for |
T1350 |
3974-3982 |
NNP |
denotes |
Northern |
T1351 |
3983-3988 |
NNS |
denotes |
bolts |
T1335 |
3989-3993 |
VBD |
denotes |
were |
T1352 |
3994-3997 |
NN |
denotes |
PCR |
T1353 |
3998-4007 |
NNS |
denotes |
fragments |
T1354 |
4008-4012 |
IN |
denotes |
from |
T1355 |
4013-4016 |
DT |
denotes |
the |
T1357 |
4017-4021 |
JJ |
denotes |
last |
T1356 |
4022-4026 |
NN |
denotes |
exon |
T1358 |
4027-4030 |
CC |
denotes |
and |
T1359 |
4031-4034 |
DT |
denotes |
the |
T1361 |
4035-4036 |
CD |
denotes |
3 |
T1363 |
4036-4037 |
SYM |
denotes |
' |
T1364 |
4038-4050 |
JJ |
denotes |
untranslated |
T1362 |
4051-4057 |
NN |
denotes |
region |
T1360 |
4058-4067 |
NNS |
denotes |
sequences |
T1365 |
4067-4068 |
. |
denotes |
. |
T1366 |
4068-4161 |
sentence |
denotes |
The mouse Acdp messages showed almost the same tissue distributions as the human ACDP genes. |
T1367 |
4069-4072 |
DT |
denotes |
The |
T1369 |
4073-4078 |
NN |
denotes |
mouse |
T1370 |
4079-4083 |
NN |
denotes |
Acdp |
T1368 |
4084-4092 |
NNS |
denotes |
messages |
T1371 |
4093-4099 |
VBD |
denotes |
showed |
T1372 |
4100-4106 |
RB |
denotes |
almost |
T1374 |
4107-4110 |
DT |
denotes |
the |
T1375 |
4111-4115 |
JJ |
denotes |
same |
T1376 |
4116-4122 |
NN |
denotes |
tissue |
T1373 |
4123-4136 |
NNS |
denotes |
distributions |
T1377 |
4137-4139 |
IN |
denotes |
as |
T1378 |
4140-4143 |
DT |
denotes |
the |
T1380 |
4144-4149 |
JJ |
denotes |
human |
T1381 |
4150-4154 |
NN |
denotes |
ACDP |
T1379 |
4155-4160 |
NNS |
denotes |
genes |
T1382 |
4160-4161 |
. |
denotes |
. |
T1383 |
4161-4271 |
sentence |
denotes |
Acdp1 message is highly expressed in the brain, while kidney and testis also showed low levels of expression. |
T1384 |
4162-4167 |
NN |
denotes |
Acdp1 |
T1385 |
4168-4175 |
NN |
denotes |
message |
T1387 |
4176-4178 |
VBZ |
denotes |
is |
T1388 |
4179-4185 |
RB |
denotes |
highly |
T1386 |
4186-4195 |
VBN |
denotes |
expressed |
T1389 |
4196-4198 |
IN |
denotes |
in |
T1390 |
4199-4202 |
DT |
denotes |
the |
T1391 |
4203-4208 |
NN |
denotes |
brain |
T1392 |
4208-4210 |
, |
denotes |
, |
T1393 |
4210-4215 |
IN |
denotes |
while |
T1395 |
4216-4222 |
NN |
denotes |
kidney |
T1396 |
4223-4226 |
CC |
denotes |
and |
T1397 |
4227-4233 |
NN |
denotes |
testis |
T1398 |
4234-4238 |
RB |
denotes |
also |
T1394 |
4239-4245 |
VBD |
denotes |
showed |
T1399 |
4246-4249 |
JJ |
denotes |
low |
T1400 |
4250-4256 |
NNS |
denotes |
levels |
T1401 |
4257-4259 |
IN |
denotes |
of |
T1402 |
4260-4270 |
NN |
denotes |
expression |
T1403 |
4270-4271 |
. |
denotes |
. |
T1404 |
4271-4335 |
sentence |
denotes |
Acdp2 showed higher expressions in the brain, kidney and liver. |
T1405 |
4272-4277 |
NN |
denotes |
Acdp2 |
T1406 |
4278-4284 |
VBD |
denotes |
showed |
T1407 |
4285-4291 |
JJR |
denotes |
higher |
T1408 |
4292-4303 |
NNS |
denotes |
expressions |
T1409 |
4304-4306 |
IN |
denotes |
in |
T1410 |
4307-4310 |
DT |
denotes |
the |
T1411 |
4311-4316 |
NN |
denotes |
brain |
T1412 |
4316-4318 |
, |
denotes |
, |
T1413 |
4318-4324 |
NN |
denotes |
kidney |
T1414 |
4325-4328 |
CC |
denotes |
and |
T1415 |
4329-4334 |
NN |
denotes |
liver |
T1416 |
4334-4335 |
. |
denotes |
. |
T1417 |
4335-4482 |
sentence |
denotes |
However, the Acdp2 transcript was not present in the skeleton muscle and skin, and it showed very low levels of expression in the rest of tissues. |
T1418 |
4336-4343 |
RB |
denotes |
However |
T1420 |
4343-4345 |
, |
denotes |
, |
T1421 |
4345-4348 |
DT |
denotes |
the |
T1423 |
4349-4354 |
NN |
denotes |
Acdp2 |
T1422 |
4355-4365 |
NN |
denotes |
transcript |
T1419 |
4366-4369 |
VBD |
denotes |
was |
T1424 |
4370-4373 |
RB |
denotes |
not |
T1425 |
4374-4381 |
JJ |
denotes |
present |
T1426 |
4382-4384 |
IN |
denotes |
in |
T1427 |
4385-4388 |
DT |
denotes |
the |
T1429 |
4389-4397 |
NN |
denotes |
skeleton |
T1428 |
4398-4404 |
NN |
denotes |
muscle |
T1430 |
4405-4408 |
CC |
denotes |
and |
T1431 |
4409-4413 |
NN |
denotes |
skin |
T1432 |
4413-4415 |
, |
denotes |
, |
T1433 |
4415-4418 |
CC |
denotes |
and |
T1434 |
4419-4421 |
PRP |
denotes |
it |
T1435 |
4422-4428 |
VBD |
denotes |
showed |
T1436 |
4429-4433 |
RB |
denotes |
very |
T1437 |
4434-4437 |
JJ |
denotes |
low |
T1438 |
4438-4444 |
NNS |
denotes |
levels |
T1439 |
4445-4447 |
IN |
denotes |
of |
T1440 |
4448-4458 |
NN |
denotes |
expression |
T1441 |
4459-4461 |
IN |
denotes |
in |
T1442 |
4462-4465 |
DT |
denotes |
the |
T1443 |
4466-4470 |
NN |
denotes |
rest |
T1444 |
4471-4473 |
IN |
denotes |
of |
T1445 |
4474-4481 |
NNS |
denotes |
tissues |
T1446 |
4481-4482 |
. |
denotes |
. |
T1447 |
4482-4741 |
sentence |
denotes |
Acdp3 and Acdp4 showed different levels of expression in all tissues tested; the highest expressions for Acdp3 were observed in the brain, kidney, liver and heart, and the highest expressions for Acdp4 were observed in the kidney, small intestine and testis. |
T1448 |
4483-4488 |
NN |
denotes |
Acdp3 |
T1450 |
4489-4492 |
CC |
denotes |
and |
T1451 |
4493-4498 |
NN |
denotes |
Acdp4 |
T1449 |
4499-4505 |
VBD |
denotes |
showed |
T1453 |
4506-4515 |
JJ |
denotes |
different |
T1454 |
4516-4522 |
NNS |
denotes |
levels |
T1455 |
4523-4525 |
IN |
denotes |
of |
T1456 |
4526-4536 |
NN |
denotes |
expression |
T1457 |
4537-4539 |
IN |
denotes |
in |
T1458 |
4540-4543 |
DT |
denotes |
all |
T1459 |
4544-4551 |
NNS |
denotes |
tissues |
T1460 |
4552-4558 |
VBN |
denotes |
tested |
T1461 |
4558-4559 |
: |
denotes |
; |
T1462 |
4560-4563 |
DT |
denotes |
the |
T1464 |
4564-4571 |
JJS |
denotes |
highest |
T1463 |
4572-4583 |
NNS |
denotes |
expressions |
T1465 |
4584-4587 |
IN |
denotes |
for |
T1466 |
4588-4593 |
NN |
denotes |
Acdp3 |
T1467 |
4594-4598 |
VBD |
denotes |
were |
T1452 |
4599-4607 |
VBN |
denotes |
observed |
T1468 |
4608-4610 |
IN |
denotes |
in |
T1469 |
4611-4614 |
DT |
denotes |
the |
T1470 |
4615-4620 |
NN |
denotes |
brain |
T1471 |
4620-4622 |
, |
denotes |
, |
T1472 |
4622-4628 |
NN |
denotes |
kidney |
T1473 |
4628-4630 |
, |
denotes |
, |
T1474 |
4630-4635 |
NN |
denotes |
liver |
T1475 |
4636-4639 |
CC |
denotes |
and |
T1476 |
4640-4645 |
NN |
denotes |
heart |
T1477 |
4645-4647 |
, |
denotes |
, |
T1478 |
4647-4650 |
CC |
denotes |
and |
T1479 |
4651-4654 |
DT |
denotes |
the |
T1481 |
4655-4662 |
JJS |
denotes |
highest |
T1480 |
4663-4674 |
NNS |
denotes |
expressions |
T1483 |
4675-4678 |
IN |
denotes |
for |
T1484 |
4679-4684 |
NN |
denotes |
Acdp4 |
T1485 |
4685-4689 |
VBD |
denotes |
were |
T1482 |
4690-4698 |
VBN |
denotes |
observed |
T1486 |
4699-4701 |
IN |
denotes |
in |
T1487 |
4702-4705 |
DT |
denotes |
the |
T1488 |
4706-4712 |
NN |
denotes |
kidney |
T1489 |
4712-4714 |
, |
denotes |
, |
T1490 |
4714-4719 |
JJ |
denotes |
small |
T1491 |
4720-4729 |
NN |
denotes |
intestine |
T1492 |
4730-4733 |
CC |
denotes |
and |
T1493 |
4734-4740 |
NN |
denotes |
testis |
T1494 |
4740-4741 |
. |
denotes |
. |
T1495 |
4741-4952 |
sentence |
denotes |
The expression levels for Acdp3 and 4 in skeleton muscle were barely detectable; however, β-actin showed normal expression suggesting that the results were not a consequence of bad RNA quality (data not shown). |
T1496 |
4742-4745 |
DT |
denotes |
The |
T1498 |
4746-4756 |
NN |
denotes |
expression |
T1497 |
4757-4763 |
NNS |
denotes |
levels |
T1500 |
4764-4767 |
IN |
denotes |
for |
T1501 |
4768-4773 |
NN |
denotes |
Acdp3 |
T1502 |
4774-4777 |
CC |
denotes |
and |
T1503 |
4778-4779 |
CD |
denotes |
4 |
T1504 |
4780-4782 |
IN |
denotes |
in |
T1505 |
4783-4791 |
NN |
denotes |
skeleton |
T1506 |
4792-4798 |
NN |
denotes |
muscle |
T1499 |
4799-4803 |
VBD |
denotes |
were |
T1508 |
4804-4810 |
RB |
denotes |
barely |
T1509 |
4811-4821 |
JJ |
denotes |
detectable |
T1510 |
4821-4822 |
: |
denotes |
; |
T1511 |
4823-4830 |
RB |
denotes |
however |
T1512 |
4830-4832 |
, |
denotes |
, |
T1513 |
4832-4833 |
NN |
denotes |
β |
T1515 |
4833-4834 |
HYPH |
denotes |
- |
T1514 |
4834-4839 |
NN |
denotes |
actin |
T1507 |
4840-4846 |
VBD |
denotes |
showed |
T1516 |
4847-4853 |
JJ |
denotes |
normal |
T1517 |
4854-4864 |
NN |
denotes |
expression |
T1518 |
4865-4875 |
VBG |
denotes |
suggesting |
T1519 |
4876-4880 |
IN |
denotes |
that |
T1521 |
4881-4884 |
DT |
denotes |
the |
T1522 |
4885-4892 |
NNS |
denotes |
results |
T1520 |
4893-4897 |
VBD |
denotes |
were |
T1523 |
4898-4901 |
RB |
denotes |
not |
T1524 |
4902-4903 |
DT |
denotes |
a |
T1525 |
4904-4915 |
NN |
denotes |
consequence |
T1526 |
4916-4918 |
IN |
denotes |
of |
T1527 |
4919-4922 |
JJ |
denotes |
bad |
T1529 |
4923-4926 |
NN |
denotes |
RNA |
T1528 |
4927-4934 |
NN |
denotes |
quality |
T1530 |
4935-4936 |
-LRB- |
denotes |
( |
T1532 |
4936-4940 |
NNS |
denotes |
data |
T1533 |
4941-4944 |
RB |
denotes |
not |
T1531 |
4945-4950 |
VBN |
denotes |
shown |
T1534 |
4950-4951 |
-RRB- |
denotes |
) |
T1535 |
4951-4952 |
. |
denotes |
. |
T1536 |
4952-5181 |
sentence |
denotes |
The ubiquitous expression pattern may be taken as another indication of the functional importance of Acdp proteins in fundamental biological processes in addition to the sequence conservation in evolutionarily divergent species. |
T1537 |
4953-4956 |
DT |
denotes |
The |
T1539 |
4957-4967 |
JJ |
denotes |
ubiquitous |
T1540 |
4968-4978 |
NN |
denotes |
expression |
T1538 |
4979-4986 |
NN |
denotes |
pattern |
T1542 |
4987-4990 |
MD |
denotes |
may |
T1543 |
4991-4993 |
VB |
denotes |
be |
T1541 |
4994-4999 |
VBN |
denotes |
taken |
T1544 |
5000-5002 |
IN |
denotes |
as |
T1545 |
5003-5010 |
DT |
denotes |
another |
T1546 |
5011-5021 |
NN |
denotes |
indication |
T1547 |
5022-5024 |
IN |
denotes |
of |
T1548 |
5025-5028 |
DT |
denotes |
the |
T1550 |
5029-5039 |
JJ |
denotes |
functional |
T1549 |
5040-5050 |
NN |
denotes |
importance |
T1551 |
5051-5053 |
IN |
denotes |
of |
T1552 |
5054-5058 |
NN |
denotes |
Acdp |
T1553 |
5059-5067 |
NN |
denotes |
proteins |
T1554 |
5068-5070 |
IN |
denotes |
in |
T1555 |
5071-5082 |
JJ |
denotes |
fundamental |
T1557 |
5083-5093 |
JJ |
denotes |
biological |
T1556 |
5094-5103 |
NNS |
denotes |
processes |
T1558 |
5104-5106 |
IN |
denotes |
in |
T1559 |
5107-5115 |
NN |
denotes |
addition |
T1560 |
5116-5118 |
IN |
denotes |
to |
T1561 |
5119-5122 |
DT |
denotes |
the |
T1563 |
5123-5131 |
NN |
denotes |
sequence |
T1562 |
5132-5144 |
NN |
denotes |
conservation |
T1564 |
5145-5147 |
IN |
denotes |
in |
T1565 |
5148-5162 |
RB |
denotes |
evolutionarily |
T1566 |
5163-5172 |
JJ |
denotes |
divergent |
T1567 |
5173-5180 |
NNS |
denotes |
species |
T1568 |
5180-5181 |
. |
denotes |
. |
T5731 |
5192-5200 |
NNP |
denotes |
Northern |
T5732 |
5201-5205 |
NN |
denotes |
blot |
T5733 |
5206-5214 |
NNS |
denotes |
analyses |
T5734 |
5215-5217 |
IN |
denotes |
of |
T5735 |
5218-5221 |
DT |
denotes |
the |
T5737 |
5222-5226 |
NN |
denotes |
Acdp |
T5738 |
5227-5231 |
NN |
denotes |
gene |
T5736 |
5232-5238 |
NN |
denotes |
family |
T5739 |
5238-5239 |
. |
denotes |
. |
T5740 |
5239-5281 |
sentence |
denotes |
S. muscle represents skeletal muscle, Sm. |
T5741 |
5240-5242 |
NN |
denotes |
S. |
T5742 |
5243-5249 |
NN |
denotes |
muscle |
T5743 |
5250-5260 |
VBZ |
denotes |
represents |
T5744 |
5261-5269 |
JJ |
denotes |
skeletal |
T5745 |
5270-5276 |
NN |
denotes |
muscle |
T5746 |
5276-5278 |
, |
denotes |
, |
T5747 |
5278-5280 |
NN |
denotes |
Sm |
T5748 |
5280-5281 |
. |
denotes |
. |
T5749 |
5281-5314 |
sentence |
denotes |
Int. represents small intestine. |
T5750 |
5282-5286 |
NN |
denotes |
Int. |
T5751 |
5287-5297 |
VBZ |
denotes |
represents |
T5752 |
5298-5303 |
JJ |
denotes |
small |
T5753 |
5304-5313 |
NN |
denotes |
intestine |
T5754 |
5313-5314 |
. |
denotes |
. |
T5755 |
5314-5381 |
sentence |
denotes |
Multiple Choice Northern Blot filters were purchased from Origene. |
T5756 |
5315-5323 |
JJ |
denotes |
Multiple |
T5757 |
5324-5330 |
NN |
denotes |
Choice |
T5759 |
5331-5339 |
NNP |
denotes |
Northern |
T5758 |
5340-5344 |
NN |
denotes |
Blot |
T5760 |
5345-5352 |
NNS |
denotes |
filters |
T5762 |
5353-5357 |
VBD |
denotes |
were |
T5761 |
5358-5367 |
VBN |
denotes |
purchased |
T5763 |
5368-5372 |
IN |
denotes |
from |
T5764 |
5373-5380 |
NNP |
denotes |
Origene |
T5765 |
5380-5381 |
. |
denotes |
. |
T1609 |
5383-5394 |
JJ |
denotes |
Chromosomal |
T1610 |
5395-5403 |
NN |
denotes |
location |
T1611 |
5403-5556 |
sentence |
denotes |
Radiation hybrid mapping indicated that the Acdp1 gene maps to chromosome 19 between markers D19Mit119 (34.3 cR proximal)and D19Mit112 (13.6 cR distal). |
T1612 |
5404-5413 |
NN |
denotes |
Radiation |
T1614 |
5414-5420 |
NN |
denotes |
hybrid |
T1613 |
5421-5428 |
NN |
denotes |
mapping |
T1615 |
5429-5438 |
VBD |
denotes |
indicated |
T1616 |
5439-5443 |
IN |
denotes |
that |
T1618 |
5444-5447 |
DT |
denotes |
the |
T1620 |
5448-5453 |
NN |
denotes |
Acdp1 |
T1619 |
5454-5458 |
NN |
denotes |
gene |
T1617 |
5459-5463 |
VBZ |
denotes |
maps |
T1621 |
5464-5466 |
IN |
denotes |
to |
T1622 |
5467-5477 |
NN |
denotes |
chromosome |
T1623 |
5478-5480 |
CD |
denotes |
19 |
T1624 |
5481-5488 |
IN |
denotes |
between |
T1625 |
5489-5496 |
NNS |
denotes |
markers |
T1626 |
5497-5506 |
NN |
denotes |
D19Mit119 |
T1627 |
5507-5508 |
-LRB- |
denotes |
( |
T1629 |
5508-5512 |
CD |
denotes |
34.3 |
T1628 |
5513-5515 |
NN |
denotes |
cR |
T1630 |
5516-5524 |
JJ |
denotes |
proximal |
T1631 |
5524-5525 |
-RRB- |
denotes |
) |
T1632 |
5525-5528 |
CC |
denotes |
and |
T1633 |
5529-5538 |
NN |
denotes |
D19Mit112 |
T1634 |
5539-5540 |
-LRB- |
denotes |
( |
T1636 |
5540-5544 |
CD |
denotes |
13.6 |
T1635 |
5545-5547 |
NN |
denotes |
cR |
T1637 |
5548-5554 |
JJ |
denotes |
distal |
T1638 |
5554-5555 |
-RRB- |
denotes |
) |
T1639 |
5555-5556 |
. |
denotes |
. |
T1640 |
5556-5692 |
sentence |
denotes |
The Acdp2 gene maps slightly more distal to the Acdp1 on chromosome 19 between D19Mit9 (2.4 cR proximal) and D19Mit38 (15.1 cR distal). |
T1641 |
5557-5560 |
DT |
denotes |
The |
T1643 |
5561-5566 |
NN |
denotes |
Acdp2 |
T1642 |
5567-5571 |
NN |
denotes |
gene |
T1644 |
5572-5576 |
VBZ |
denotes |
maps |
T1645 |
5577-5585 |
RB |
denotes |
slightly |
T1646 |
5586-5590 |
RBR |
denotes |
more |
T1647 |
5591-5597 |
JJ |
denotes |
distal |
T1648 |
5598-5600 |
IN |
denotes |
to |
T1649 |
5601-5604 |
DT |
denotes |
the |
T1650 |
5605-5610 |
NN |
denotes |
Acdp1 |
T1651 |
5611-5613 |
IN |
denotes |
on |
T1652 |
5614-5624 |
NN |
denotes |
chromosome |
T1653 |
5625-5627 |
CD |
denotes |
19 |
T1654 |
5628-5635 |
IN |
denotes |
between |
T1655 |
5636-5643 |
NN |
denotes |
D19Mit9 |
T1656 |
5644-5645 |
-LRB- |
denotes |
( |
T1658 |
5645-5648 |
CD |
denotes |
2.4 |
T1657 |
5649-5651 |
NN |
denotes |
cR |
T1659 |
5652-5660 |
JJ |
denotes |
proximal |
T1660 |
5660-5661 |
-RRB- |
denotes |
) |
T1661 |
5662-5665 |
CC |
denotes |
and |
T1662 |
5666-5674 |
NN |
denotes |
D19Mit38 |
T1663 |
5675-5676 |
-LRB- |
denotes |
( |
T1665 |
5676-5680 |
CD |
denotes |
15.1 |
T1664 |
5681-5683 |
NN |
denotes |
cR |
T1666 |
5684-5690 |
JJ |
denotes |
distal |
T1667 |
5690-5691 |
-RRB- |
denotes |
) |
T1668 |
5691-5692 |
. |
denotes |
. |
T1669 |
5692-5813 |
sentence |
denotes |
The Acdp3 and Acdp4 genes map to chromosome 1 within one BAC clone (RP23-294I17), proximal to marker D1Mit171 (17.4 cR). |
T1670 |
5693-5696 |
DT |
denotes |
The |
T1672 |
5697-5702 |
NN |
denotes |
Acdp3 |
T1673 |
5703-5706 |
CC |
denotes |
and |
T1674 |
5707-5712 |
NN |
denotes |
Acdp4 |
T1671 |
5713-5718 |
NNS |
denotes |
genes |
T1675 |
5719-5722 |
VBP |
denotes |
map |
T1676 |
5723-5725 |
IN |
denotes |
to |
T1677 |
5726-5736 |
NN |
denotes |
chromosome |
T1678 |
5737-5738 |
CD |
denotes |
1 |
T1679 |
5739-5745 |
IN |
denotes |
within |
T1680 |
5746-5749 |
CD |
denotes |
one |
T1682 |
5750-5753 |
NN |
denotes |
BAC |
T1681 |
5754-5759 |
NN |
denotes |
clone |
T1683 |
5760-5761 |
-LRB- |
denotes |
( |
T1685 |
5761-5765 |
NN |
denotes |
RP23 |
T1686 |
5765-5766 |
HYPH |
denotes |
- |
T1684 |
5766-5772 |
NN |
denotes |
294I17 |
T1687 |
5772-5773 |
-RRB- |
denotes |
) |
T1688 |
5773-5775 |
, |
denotes |
, |
T1689 |
5775-5783 |
JJ |
denotes |
proximal |
T1690 |
5784-5786 |
IN |
denotes |
to |
T1691 |
5787-5793 |
NN |
denotes |
marker |
T1692 |
5794-5802 |
NN |
denotes |
D1Mit171 |
T1693 |
5803-5804 |
-LRB- |
denotes |
( |
T1695 |
5804-5808 |
CD |
denotes |
17.4 |
T1694 |
5809-5811 |
NN |
denotes |
cR |
T1696 |
5811-5812 |
-RRB- |
denotes |
) |
T1697 |
5812-5813 |
. |
denotes |
. |
T1698 |
5813-5867 |
sentence |
denotes |
These regions are syntenic to the human counterparts. |
T1699 |
5814-5819 |
DT |
denotes |
These |
T1700 |
5820-5827 |
NNS |
denotes |
regions |
T1701 |
5828-5831 |
VBP |
denotes |
are |
T1702 |
5832-5840 |
JJ |
denotes |
syntenic |
T1703 |
5841-5843 |
IN |
denotes |
to |
T1704 |
5844-5847 |
DT |
denotes |
the |
T1706 |
5848-5853 |
JJ |
denotes |
human |
T1705 |
5854-5866 |
NNS |
denotes |
counterparts |
T1707 |
5866-5867 |
. |
denotes |
. |
T2019 |
5869-5877 |
NN |
denotes |
Sequence |
T2020 |
5878-5886 |
NN |
denotes |
homology |
T2021 |
5887-5890 |
CC |
denotes |
and |
T2022 |
5891-5900 |
JJ |
denotes |
molecular |
T2023 |
5901-5916 |
NNS |
denotes |
characteristics |
T2024 |
5916-6038 |
sentence |
denotes |
The mouse Acdp genes showed very strong homologies of both nucleotide and AA sequences to the human ACDP genes (Table 1). |
T2025 |
5917-5920 |
DT |
denotes |
The |
T2027 |
5921-5926 |
NN |
denotes |
mouse |
T2028 |
5927-5931 |
NN |
denotes |
Acdp |
T2026 |
5932-5937 |
NNS |
denotes |
genes |
T2029 |
5938-5944 |
VBD |
denotes |
showed |
T2030 |
5945-5949 |
RB |
denotes |
very |
T2031 |
5950-5956 |
JJ |
denotes |
strong |
T2032 |
5957-5967 |
NNS |
denotes |
homologies |
T2033 |
5968-5970 |
IN |
denotes |
of |
T2034 |
5971-5975 |
CC |
denotes |
both |
T2035 |
5976-5986 |
NN |
denotes |
nucleotide |
T2037 |
5987-5990 |
CC |
denotes |
and |
T2038 |
5991-5993 |
NN |
denotes |
AA |
T2036 |
5994-6003 |
NNS |
denotes |
sequences |
T2039 |
6004-6006 |
IN |
denotes |
to |
T2040 |
6007-6010 |
DT |
denotes |
the |
T2042 |
6011-6016 |
JJ |
denotes |
human |
T2043 |
6017-6021 |
NN |
denotes |
ACDP |
T2041 |
6022-6027 |
NNS |
denotes |
genes |
T2044 |
6028-6029 |
-LRB- |
denotes |
( |
T2045 |
6029-6034 |
NN |
denotes |
Table |
T2046 |
6035-6036 |
CD |
denotes |
1 |
T2047 |
6036-6037 |
-RRB- |
denotes |
) |
T2048 |
6037-6038 |
. |
denotes |
. |
T2049 |
6038-6199 |
sentence |
denotes |
The highest homologies were observed between the human ACDP2 and the mouse Acdp2 gene (91% of nucleotide identity, 97% of AA identity and 99.4% of AA homology). |
T2050 |
6039-6042 |
DT |
denotes |
The |
T2052 |
6043-6050 |
JJS |
denotes |
highest |
T2051 |
6051-6061 |
NNS |
denotes |
homologies |
T2054 |
6062-6066 |
VBD |
denotes |
were |
T2053 |
6067-6075 |
VBN |
denotes |
observed |
T2055 |
6076-6083 |
IN |
denotes |
between |
T2056 |
6084-6087 |
DT |
denotes |
the |
T2058 |
6088-6093 |
JJ |
denotes |
human |
T2057 |
6094-6099 |
NN |
denotes |
ACDP2 |
T2059 |
6100-6103 |
CC |
denotes |
and |
T2060 |
6104-6107 |
DT |
denotes |
the |
T2062 |
6108-6113 |
NN |
denotes |
mouse |
T2061 |
6114-6119 |
NN |
denotes |
Acdp2 |
T2063 |
6120-6124 |
NN |
denotes |
gene |
T2064 |
6125-6126 |
-LRB- |
denotes |
( |
T2066 |
6126-6128 |
CD |
denotes |
91 |
T2065 |
6128-6129 |
NN |
denotes |
% |
T2067 |
6130-6132 |
IN |
denotes |
of |
T2068 |
6133-6143 |
NN |
denotes |
nucleotide |
T2069 |
6144-6152 |
NN |
denotes |
identity |
T2070 |
6152-6154 |
, |
denotes |
, |
T2071 |
6154-6156 |
CD |
denotes |
97 |
T2072 |
6156-6157 |
NN |
denotes |
% |
T2073 |
6158-6160 |
IN |
denotes |
of |
T2074 |
6161-6163 |
NN |
denotes |
AA |
T2075 |
6164-6172 |
NN |
denotes |
identity |
T2076 |
6173-6176 |
CC |
denotes |
and |
T2077 |
6177-6181 |
CD |
denotes |
99.4 |
T2078 |
6181-6182 |
NN |
denotes |
% |
T2079 |
6183-6185 |
IN |
denotes |
of |
T2080 |
6186-6188 |
NN |
denotes |
AA |
T2081 |
6189-6197 |
NN |
denotes |
homology |
T2082 |
6197-6198 |
-RRB- |
denotes |
) |
T2083 |
6198-6199 |
. |
denotes |
. |
T2084 |
6199-6420 |
sentence |
denotes |
In addition, the 5' UTR nucleotide sequences (20 bp of nucleotides before start codon) also showed high homologies to the human homologs, for example, the Acdp2 5' UTR sequence showed 95% identities to its human homolog. |
T2085 |
6200-6202 |
IN |
denotes |
In |
T2087 |
6203-6211 |
NN |
denotes |
addition |
T2088 |
6211-6213 |
, |
denotes |
, |
T2089 |
6213-6216 |
DT |
denotes |
the |
T2091 |
6217-6218 |
CD |
denotes |
5 |
T2093 |
6218-6219 |
SYM |
denotes |
' |
T2092 |
6220-6223 |
NN |
denotes |
UTR |
T2094 |
6224-6234 |
NN |
denotes |
nucleotide |
T2090 |
6235-6244 |
NNS |
denotes |
sequences |
T2095 |
6245-6246 |
-LRB- |
denotes |
( |
T2097 |
6246-6248 |
CD |
denotes |
20 |
T2096 |
6249-6251 |
NNS |
denotes |
bp |
T2098 |
6252-6254 |
IN |
denotes |
of |
T2099 |
6255-6266 |
NNS |
denotes |
nucleotides |
T2100 |
6267-6273 |
IN |
denotes |
before |
T2101 |
6274-6279 |
NN |
denotes |
start |
T2102 |
6280-6285 |
NN |
denotes |
codon |
T2103 |
6285-6286 |
-RRB- |
denotes |
) |
T2104 |
6287-6291 |
RB |
denotes |
also |
T2086 |
6292-6298 |
VBD |
denotes |
showed |
T2106 |
6299-6303 |
JJ |
denotes |
high |
T2107 |
6304-6314 |
NNS |
denotes |
homologies |
T2108 |
6315-6317 |
IN |
denotes |
to |
T2109 |
6318-6321 |
DT |
denotes |
the |
T2111 |
6322-6327 |
JJ |
denotes |
human |
T2110 |
6328-6336 |
NNS |
denotes |
homologs |
T2112 |
6336-6338 |
, |
denotes |
, |
T2113 |
6338-6341 |
IN |
denotes |
for |
T2114 |
6342-6349 |
NN |
denotes |
example |
T2115 |
6349-6351 |
, |
denotes |
, |
T2116 |
6351-6354 |
DT |
denotes |
the |
T2118 |
6355-6360 |
NN |
denotes |
Acdp2 |
T2119 |
6361-6362 |
CD |
denotes |
5 |
T2121 |
6362-6363 |
SYM |
denotes |
' |
T2120 |
6364-6367 |
NN |
denotes |
UTR |
T2117 |
6368-6376 |
NN |
denotes |
sequence |
T2105 |
6377-6383 |
VBD |
denotes |
showed |
T2122 |
6384-6386 |
CD |
denotes |
95 |
T2123 |
6386-6387 |
NN |
denotes |
% |
T2124 |
6388-6398 |
NNS |
denotes |
identities |
T2125 |
6399-6401 |
IN |
denotes |
to |
T2126 |
6402-6405 |
PRP$ |
denotes |
its |
T2128 |
6406-6411 |
JJ |
denotes |
human |
T2127 |
6412-6419 |
NN |
denotes |
homolog |
T2129 |
6419-6420 |
. |
denotes |
. |
T2130 |
6420-6602 |
sentence |
denotes |
However, the homologies in the 3' UTR sequences (20 bp of nucleotides after stop codon) were much lower (40–55%) for all Acdp genes except Acdp4 (90% identity to its human homolog). |
T2131 |
6421-6428 |
RB |
denotes |
However |
T2133 |
6428-6430 |
, |
denotes |
, |
T2134 |
6430-6433 |
DT |
denotes |
the |
T2135 |
6434-6444 |
NNS |
denotes |
homologies |
T2136 |
6445-6447 |
IN |
denotes |
in |
T2137 |
6448-6451 |
DT |
denotes |
the |
T2139 |
6452-6453 |
CD |
denotes |
3 |
T2141 |
6453-6454 |
SYM |
denotes |
' |
T2140 |
6455-6458 |
NN |
denotes |
UTR |
T2138 |
6459-6468 |
NNS |
denotes |
sequences |
T2142 |
6469-6470 |
-LRB- |
denotes |
( |
T2144 |
6470-6472 |
CD |
denotes |
20 |
T2143 |
6473-6475 |
NNS |
denotes |
bp |
T2145 |
6476-6478 |
IN |
denotes |
of |
T2146 |
6479-6490 |
NNS |
denotes |
nucleotides |
T2147 |
6491-6496 |
IN |
denotes |
after |
T2148 |
6497-6501 |
NN |
denotes |
stop |
T2149 |
6502-6507 |
NN |
denotes |
codon |
T2150 |
6507-6508 |
-RRB- |
denotes |
) |
T2132 |
6509-6513 |
VBD |
denotes |
were |
T2151 |
6514-6518 |
RB |
denotes |
much |
T2152 |
6519-6524 |
JJR |
denotes |
lower |
T2153 |
6525-6526 |
-LRB- |
denotes |
( |
T2155 |
6526-6528 |
CD |
denotes |
40 |
T2157 |
6528-6529 |
SYM |
denotes |
– |
T2156 |
6529-6531 |
CD |
denotes |
55 |
T2154 |
6531-6532 |
NN |
denotes |
% |
T2158 |
6532-6533 |
-RRB- |
denotes |
) |
T2159 |
6534-6537 |
IN |
denotes |
for |
T2160 |
6538-6541 |
DT |
denotes |
all |
T2162 |
6542-6546 |
NN |
denotes |
Acdp |
T2161 |
6547-6552 |
NNS |
denotes |
genes |
T2163 |
6553-6559 |
IN |
denotes |
except |
T2164 |
6560-6565 |
NN |
denotes |
Acdp4 |
T2165 |
6566-6567 |
-LRB- |
denotes |
( |
T2167 |
6567-6569 |
CD |
denotes |
90 |
T2168 |
6569-6570 |
NN |
denotes |
% |
T2166 |
6571-6579 |
NN |
denotes |
identity |
T2169 |
6580-6582 |
IN |
denotes |
to |
T2170 |
6583-6586 |
PRP$ |
denotes |
its |
T2172 |
6587-6592 |
JJ |
denotes |
human |
T2171 |
6593-6600 |
NN |
denotes |
homolog |
T2173 |
6600-6601 |
-RRB- |
denotes |
) |
T2174 |
6601-6602 |
. |
denotes |
. |
T2175 |
6602-6736 |
sentence |
denotes |
The ancient conserved domain (ACD) has 55.3% of AA identity and 83.3% of homology between all mouse and human ACDP proteins (Fig. 2). |
T2176 |
6603-6606 |
DT |
denotes |
The |
T2178 |
6607-6614 |
JJ |
denotes |
ancient |
T2179 |
6615-6624 |
VBN |
denotes |
conserved |
T2177 |
6625-6631 |
NN |
denotes |
domain |
T2181 |
6632-6633 |
-LRB- |
denotes |
( |
T2182 |
6633-6636 |
NN |
denotes |
ACD |
T2183 |
6636-6637 |
-RRB- |
denotes |
) |
T2180 |
6638-6641 |
VBZ |
denotes |
has |
T2184 |
6642-6646 |
CD |
denotes |
55.3 |
T2185 |
6646-6647 |
NN |
denotes |
% |
T2186 |
6648-6650 |
IN |
denotes |
of |
T2187 |
6651-6653 |
NN |
denotes |
AA |
T2188 |
6654-6662 |
NN |
denotes |
identity |
T2189 |
6663-6666 |
CC |
denotes |
and |
T2190 |
6667-6671 |
CD |
denotes |
83.3 |
T2191 |
6671-6672 |
NN |
denotes |
% |
T2192 |
6673-6675 |
IN |
denotes |
of |
T2193 |
6676-6684 |
NN |
denotes |
homology |
T2194 |
6685-6692 |
IN |
denotes |
between |
T2195 |
6693-6696 |
DT |
denotes |
all |
T2197 |
6697-6702 |
NN |
denotes |
mouse |
T2198 |
6703-6706 |
CC |
denotes |
and |
T2199 |
6707-6712 |
JJ |
denotes |
human |
T2200 |
6713-6717 |
NN |
denotes |
ACDP |
T2196 |
6718-6726 |
NN |
denotes |
proteins |
T2201 |
6727-6728 |
-LRB- |
denotes |
( |
T2202 |
6728-6732 |
NN |
denotes |
Fig. |
T2203 |
6733-6734 |
CD |
denotes |
2 |
T2204 |
6734-6735 |
-RRB- |
denotes |
) |
T2205 |
6735-6736 |
. |
denotes |
. |
T2206 |
6736-6884 |
sentence |
denotes |
The ACD domain is evolutionarily conserved in divergent species ranging from bacteria, yeast, C. elegans, D. melanogaster, mouse to human (Fig. 3). |
T2207 |
6737-6740 |
DT |
denotes |
The |
T2209 |
6741-6744 |
NN |
denotes |
ACD |
T2208 |
6745-6751 |
NN |
denotes |
domain |
T2211 |
6752-6754 |
VBZ |
denotes |
is |
T2212 |
6755-6769 |
RB |
denotes |
evolutionarily |
T2210 |
6770-6779 |
VBN |
denotes |
conserved |
T2213 |
6780-6782 |
IN |
denotes |
in |
T2214 |
6783-6792 |
JJ |
denotes |
divergent |
T2215 |
6793-6800 |
NNS |
denotes |
species |
T2216 |
6801-6808 |
VBG |
denotes |
ranging |
T2217 |
6809-6813 |
IN |
denotes |
from |
T2218 |
6814-6822 |
NNS |
denotes |
bacteria |
T2219 |
6822-6824 |
, |
denotes |
, |
T2220 |
6824-6829 |
NN |
denotes |
yeast |
T2221 |
6829-6831 |
, |
denotes |
, |
T2222 |
6831-6833 |
NNP |
denotes |
C. |
T2223 |
6834-6841 |
NNP |
denotes |
elegans |
T2224 |
6841-6843 |
, |
denotes |
, |
T2225 |
6843-6845 |
NNP |
denotes |
D. |
T2226 |
6846-6858 |
NNP |
denotes |
melanogaster |
T2227 |
6858-6860 |
, |
denotes |
, |
T2228 |
6860-6865 |
NN |
denotes |
mouse |
T2229 |
6866-6868 |
IN |
denotes |
to |
T2230 |
6869-6874 |
JJ |
denotes |
human |
T2231 |
6875-6876 |
-LRB- |
denotes |
( |
T2232 |
6876-6880 |
NN |
denotes |
Fig. |
T2233 |
6881-6882 |
CD |
denotes |
3 |
T2234 |
6882-6883 |
-RRB- |
denotes |
) |
T2235 |
6883-6884 |
. |
denotes |
. |
T2236 |
6884-7079 |
sentence |
denotes |
Particularly, as shown in Fig. 3, Acdp proteins showed very strong AA homology to bacteria CorC protein (35% AA identity with 55% homology), which is involved in magnesium and cobalt efflux [7]. |
T2237 |
6885-6897 |
RB |
denotes |
Particularly |
T2239 |
6897-6899 |
, |
denotes |
, |
T2240 |
6899-6901 |
IN |
denotes |
as |
T2241 |
6902-6907 |
VBN |
denotes |
shown |
T2242 |
6908-6910 |
IN |
denotes |
in |
T2243 |
6911-6915 |
NN |
denotes |
Fig. |
T2244 |
6916-6917 |
CD |
denotes |
3 |
T2245 |
6917-6919 |
, |
denotes |
, |
T2246 |
6919-6923 |
NN |
denotes |
Acdp |
T2247 |
6924-6932 |
NN |
denotes |
proteins |
T2238 |
6933-6939 |
VBD |
denotes |
showed |
T2248 |
6940-6944 |
RB |
denotes |
very |
T2249 |
6945-6951 |
JJ |
denotes |
strong |
T2251 |
6952-6954 |
NN |
denotes |
AA |
T2250 |
6955-6963 |
NN |
denotes |
homology |
T2252 |
6964-6966 |
IN |
denotes |
to |
T2253 |
6967-6975 |
NNS |
denotes |
bacteria |
T2255 |
6976-6980 |
NN |
denotes |
CorC |
T2254 |
6981-6988 |
NN |
denotes |
protein |
T2256 |
6989-6990 |
-LRB- |
denotes |
( |
T2258 |
6990-6992 |
CD |
denotes |
35 |
T2259 |
6992-6993 |
NN |
denotes |
% |
T2260 |
6994-6996 |
NN |
denotes |
AA |
T2257 |
6997-7005 |
NN |
denotes |
identity |
T2261 |
7006-7010 |
IN |
denotes |
with |
T2262 |
7011-7013 |
CD |
denotes |
55 |
T2263 |
7013-7014 |
NN |
denotes |
% |
T2264 |
7015-7023 |
NN |
denotes |
homology |
T2265 |
7023-7024 |
-RRB- |
denotes |
) |
T2266 |
7024-7026 |
, |
denotes |
, |
T2267 |
7026-7031 |
WDT |
denotes |
which |
T2269 |
7032-7034 |
VBZ |
denotes |
is |
T2268 |
7035-7043 |
VBN |
denotes |
involved |
T2270 |
7044-7046 |
IN |
denotes |
in |
T2271 |
7047-7056 |
NN |
denotes |
magnesium |
T2273 |
7057-7060 |
CC |
denotes |
and |
T2274 |
7061-7067 |
NN |
denotes |
cobalt |
T2272 |
7068-7074 |
NN |
denotes |
efflux |
T2275 |
7075-7076 |
-LRB- |
denotes |
[ |
T2276 |
7076-7077 |
CD |
denotes |
7 |
T2277 |
7077-7078 |
-RRB- |
denotes |
] |
T2278 |
7078-7079 |
. |
denotes |
. |
T2279 |
7079-7205 |
sentence |
denotes |
High AA homology was also observed between the Acdp proteins and the yeast Amip3 protein (35% AA identity with 56% homology). |
T2280 |
7080-7084 |
JJ |
denotes |
High |
T2282 |
7085-7087 |
NN |
denotes |
AA |
T2281 |
7088-7096 |
NN |
denotes |
homology |
T2284 |
7097-7100 |
VBD |
denotes |
was |
T2285 |
7101-7105 |
RB |
denotes |
also |
T2283 |
7106-7114 |
VBN |
denotes |
observed |
T2286 |
7115-7122 |
IN |
denotes |
between |
T2287 |
7123-7126 |
DT |
denotes |
the |
T2289 |
7127-7131 |
NN |
denotes |
Acdp |
T2288 |
7132-7140 |
NN |
denotes |
proteins |
T2290 |
7141-7144 |
CC |
denotes |
and |
T2291 |
7145-7148 |
DT |
denotes |
the |
T2293 |
7149-7154 |
NN |
denotes |
yeast |
T2294 |
7155-7160 |
NN |
denotes |
Amip3 |
T2292 |
7161-7168 |
NN |
denotes |
protein |
T2295 |
7169-7170 |
-LRB- |
denotes |
( |
T2297 |
7170-7172 |
CD |
denotes |
35 |
T2298 |
7172-7173 |
NN |
denotes |
% |
T2299 |
7174-7176 |
NN |
denotes |
AA |
T2296 |
7177-7185 |
NN |
denotes |
identity |
T2300 |
7186-7190 |
IN |
denotes |
with |
T2301 |
7191-7193 |
CD |
denotes |
56 |
T2303 |
7193-7194 |
NN |
denotes |
% |
T2302 |
7195-7203 |
NN |
denotes |
homology |
T2304 |
7203-7204 |
-RRB- |
denotes |
) |
T2305 |
7204-7205 |
. |
denotes |
. |
T2306 |
7205-7274 |
sentence |
denotes |
The Amip3 is likely to be a homologous to the bacteria CorC protein. |
T2307 |
7206-7209 |
DT |
denotes |
The |
T2308 |
7210-7215 |
NN |
denotes |
Amip3 |
T2309 |
7216-7218 |
VBZ |
denotes |
is |
T2310 |
7219-7225 |
JJ |
denotes |
likely |
T2311 |
7226-7228 |
TO |
denotes |
to |
T2312 |
7229-7231 |
VB |
denotes |
be |
T2313 |
7232-7233 |
DT |
denotes |
a |
T2314 |
7234-7244 |
JJ |
denotes |
homologous |
T2315 |
7245-7247 |
IN |
denotes |
to |
T2316 |
7248-7251 |
DT |
denotes |
the |
T2318 |
7252-7260 |
NNS |
denotes |
bacteria |
T2319 |
7261-7265 |
NN |
denotes |
CorC |
T2317 |
7266-7273 |
NN |
denotes |
protein |
T2320 |
7273-7274 |
. |
denotes |
. |
T2321 |
7274-7426 |
sentence |
denotes |
The Amip3 mutants confer resistance to copper toxicity (Personal communication with Dr. V.C. Culotte, John Hopkins Bloomberg, School of Public Health). |
T2322 |
7275-7278 |
DT |
denotes |
The |
T2324 |
7279-7284 |
NN |
denotes |
Amip3 |
T2323 |
7285-7292 |
NNS |
denotes |
mutants |
T2325 |
7293-7299 |
VBP |
denotes |
confer |
T2326 |
7300-7310 |
NN |
denotes |
resistance |
T2327 |
7311-7313 |
IN |
denotes |
to |
T2328 |
7314-7320 |
NN |
denotes |
copper |
T2329 |
7321-7329 |
NN |
denotes |
toxicity |
T2330 |
7330-7331 |
-LRB- |
denotes |
( |
T2332 |
7331-7339 |
JJ |
denotes |
Personal |
T2333 |
7340-7353 |
NN |
denotes |
communication |
T2334 |
7354-7358 |
IN |
denotes |
with |
T2331 |
7359-7362 |
NNP |
denotes |
Dr. |
T2335 |
7363-7367 |
NNP |
denotes |
V.C. |
T2336 |
7368-7375 |
NNP |
denotes |
Culotte |
T2337 |
7375-7377 |
, |
denotes |
, |
T2338 |
7377-7381 |
NNP |
denotes |
John |
T2339 |
7382-7389 |
NNP |
denotes |
Hopkins |
T2340 |
7390-7399 |
NNP |
denotes |
Bloomberg |
T2341 |
7399-7401 |
, |
denotes |
, |
T2342 |
7401-7407 |
NNP |
denotes |
School |
T2343 |
7408-7410 |
IN |
denotes |
of |
T2344 |
7411-7417 |
NNP |
denotes |
Public |
T2345 |
7418-7424 |
NNP |
denotes |
Health |
T2346 |
7424-7425 |
-RRB- |
denotes |
) |
T2347 |
7425-7426 |
. |
denotes |
. |
T2348 |
7426-7576 |
sentence |
denotes |
The evolutionary relationships among those proteins are illustrated by a phylogenetic tree constructed based on the AA homology of proteins (Fig. 4). |
T2349 |
7427-7430 |
DT |
denotes |
The |
T2351 |
7431-7443 |
JJ |
denotes |
evolutionary |
T2350 |
7444-7457 |
NNS |
denotes |
relationships |
T2353 |
7458-7463 |
IN |
denotes |
among |
T2354 |
7464-7469 |
DT |
denotes |
those |
T2355 |
7470-7478 |
NN |
denotes |
proteins |
T2356 |
7479-7482 |
VBP |
denotes |
are |
T2352 |
7483-7494 |
VBN |
denotes |
illustrated |
T2357 |
7495-7497 |
IN |
denotes |
by |
T2358 |
7498-7499 |
DT |
denotes |
a |
T2360 |
7500-7512 |
JJ |
denotes |
phylogenetic |
T2359 |
7513-7517 |
NN |
denotes |
tree |
T2361 |
7518-7529 |
VBN |
denotes |
constructed |
T2362 |
7530-7535 |
VBN |
denotes |
based |
T2363 |
7536-7538 |
IN |
denotes |
on |
T2364 |
7539-7542 |
DT |
denotes |
the |
T2366 |
7543-7545 |
NN |
denotes |
AA |
T2365 |
7546-7554 |
NN |
denotes |
homology |
T2367 |
7555-7557 |
IN |
denotes |
of |
T2368 |
7558-7566 |
NN |
denotes |
proteins |
T2369 |
7567-7568 |
-LRB- |
denotes |
( |
T2370 |
7568-7572 |
NN |
denotes |
Fig. |
T2371 |
7573-7574 |
CD |
denotes |
4 |
T2372 |
7574-7575 |
-RRB- |
denotes |
) |
T2373 |
7575-7576 |
. |
denotes |
. |
T2374 |
7576-7577 |
sentence |
denotes |
|
T6623 |
7586-7596 |
NN |
denotes |
Nucleotide |
T6625 |
7597-7600 |
CC |
denotes |
and |
T6626 |
7601-7606 |
NN |
denotes |
amino |
T6627 |
7607-7611 |
NN |
denotes |
acid |
T6624 |
7612-7622 |
NNS |
denotes |
homologies |
T6628 |
7623-7624 |
-LRB- |
denotes |
( |
T6629 |
7624-7625 |
NN |
denotes |
% |
T6630 |
7625-7626 |
-RRB- |
denotes |
) |
T6631 |
7627-7634 |
IN |
denotes |
between |
T6632 |
7635-7640 |
JJ |
denotes |
human |
T6633 |
7641-7645 |
NN |
denotes |
ACDP |
T6635 |
7646-7649 |
CC |
denotes |
and |
T6636 |
7650-7655 |
NN |
denotes |
mouse |
T6637 |
7656-7660 |
NN |
denotes |
Acdp |
T6634 |
7661-7668 |
NNS |
denotes |
members |
T6638 |
7668-7669 |
. |
denotes |
. |
T5826 |
7856-7861 |
NN |
denotes |
Amino |
T5827 |
7862-7866 |
NN |
denotes |
acid |
T5828 |
7867-7875 |
NN |
denotes |
sequence |
T5830 |
7876-7884 |
NN |
denotes |
homology |
T5829 |
7885-7894 |
NN |
denotes |
alignment |
T5831 |
7895-7898 |
IN |
denotes |
for |
T5832 |
7899-7902 |
DT |
denotes |
all |
T5833 |
7903-7905 |
IN |
denotes |
of |
T5834 |
7906-7909 |
DT |
denotes |
the |
T5836 |
7910-7914 |
NN |
denotes |
ACDP |
T5837 |
7915-7918 |
CC |
denotes |
and |
T5838 |
7919-7923 |
NN |
denotes |
Acdp |
T5835 |
7924-7929 |
NNS |
denotes |
genes |
T5839 |
7930-7936 |
IN |
denotes |
within |
T5840 |
7937-7940 |
DT |
denotes |
the |
T5842 |
7941-7944 |
NN |
denotes |
ACD |
T5841 |
7945-7951 |
NN |
denotes |
domain |
T5843 |
7951-7952 |
. |
denotes |
. |
T5844 |
7952-8118 |
sentence |
denotes |
The sequence data for the Acdp genes have been deposited in GenBank under accession number AF202994 (Acdp1), AF216961 (Acdp2), AF216964 (Acdp3) and AF216963 (Acdp4). |
T5845 |
7953-7956 |
DT |
denotes |
The |
T5847 |
7957-7965 |
NN |
denotes |
sequence |
T5846 |
7966-7970 |
NNS |
denotes |
data |
T5849 |
7971-7974 |
IN |
denotes |
for |
T5850 |
7975-7978 |
DT |
denotes |
the |
T5852 |
7979-7983 |
NN |
denotes |
Acdp |
T5851 |
7984-7989 |
NNS |
denotes |
genes |
T5853 |
7990-7994 |
VBP |
denotes |
have |
T5854 |
7995-7999 |
VBN |
denotes |
been |
T5848 |
8000-8009 |
VBN |
denotes |
deposited |
T5855 |
8010-8012 |
IN |
denotes |
in |
T5856 |
8013-8020 |
NNP |
denotes |
GenBank |
T5857 |
8021-8026 |
IN |
denotes |
under |
T5858 |
8027-8036 |
NN |
denotes |
accession |
T5860 |
8037-8043 |
NN |
denotes |
number |
T5859 |
8044-8052 |
NN |
denotes |
AF202994 |
T5861 |
8053-8054 |
-LRB- |
denotes |
( |
T5862 |
8054-8059 |
NN |
denotes |
Acdp1 |
T5863 |
8059-8060 |
-RRB- |
denotes |
) |
T5864 |
8060-8062 |
, |
denotes |
, |
T5865 |
8062-8070 |
NN |
denotes |
AF216961 |
T5866 |
8071-8072 |
-LRB- |
denotes |
( |
T5867 |
8072-8077 |
NN |
denotes |
Acdp2 |
T5868 |
8077-8078 |
-RRB- |
denotes |
) |
T5869 |
8078-8080 |
, |
denotes |
, |
T5870 |
8080-8088 |
NN |
denotes |
AF216964 |
T5871 |
8089-8090 |
-LRB- |
denotes |
( |
T5872 |
8090-8095 |
NN |
denotes |
Acdp3 |
T5873 |
8095-8096 |
-RRB- |
denotes |
) |
T5874 |
8097-8100 |
CC |
denotes |
and |
T5875 |
8101-8109 |
NN |
denotes |
AF216963 |
T5876 |
8110-8111 |
-LRB- |
denotes |
( |
T5877 |
8111-8116 |
NN |
denotes |
Acdp4 |
T5878 |
8116-8117 |
-RRB- |
denotes |
) |
T5879 |
8117-8118 |
. |
denotes |
. |
T5880 |
8118-8221 |
sentence |
denotes |
Identical amino acids or amino acids with very strong homologies among all proteins were shaded black. |
T5881 |
8119-8128 |
JJ |
denotes |
Identical |
T5883 |
8129-8134 |
NN |
denotes |
amino |
T5882 |
8135-8140 |
NNS |
denotes |
acids |
T5885 |
8141-8143 |
CC |
denotes |
or |
T5886 |
8144-8149 |
NN |
denotes |
amino |
T5887 |
8150-8155 |
NNS |
denotes |
acids |
T5888 |
8156-8160 |
IN |
denotes |
with |
T5889 |
8161-8165 |
RB |
denotes |
very |
T5890 |
8166-8172 |
JJ |
denotes |
strong |
T5891 |
8173-8183 |
NNS |
denotes |
homologies |
T5892 |
8184-8189 |
IN |
denotes |
among |
T5893 |
8190-8193 |
DT |
denotes |
all |
T5894 |
8194-8202 |
NN |
denotes |
proteins |
T5895 |
8203-8207 |
VBD |
denotes |
were |
T5884 |
8208-8214 |
VBN |
denotes |
shaded |
T5896 |
8215-8220 |
JJ |
denotes |
black |
T5897 |
8220-8221 |
. |
denotes |
. |
T5898 |
8221-8328 |
sentence |
denotes |
Identical amino acids or amino acids with very strong homologies in most of the proteins were shaded grey. |
T5899 |
8222-8231 |
JJ |
denotes |
Identical |
T5901 |
8232-8237 |
NN |
denotes |
amino |
T5900 |
8238-8243 |
NNS |
denotes |
acids |
T5903 |
8244-8246 |
CC |
denotes |
or |
T5904 |
8247-8252 |
NN |
denotes |
amino |
T5905 |
8253-8258 |
NNS |
denotes |
acids |
T5906 |
8259-8263 |
IN |
denotes |
with |
T5907 |
8264-8268 |
RB |
denotes |
very |
T5908 |
8269-8275 |
JJ |
denotes |
strong |
T5909 |
8276-8286 |
NNS |
denotes |
homologies |
T5910 |
8287-8289 |
IN |
denotes |
in |
T5911 |
8290-8294 |
JJS |
denotes |
most |
T5912 |
8295-8297 |
IN |
denotes |
of |
T5913 |
8298-8301 |
DT |
denotes |
the |
T5914 |
8302-8310 |
NN |
denotes |
proteins |
T5915 |
8311-8315 |
VBD |
denotes |
were |
T5902 |
8316-8322 |
VBN |
denotes |
shaded |
T5916 |
8323-8327 |
JJ |
denotes |
grey |
T5917 |
8327-8328 |
. |
denotes |
. |
T5918 |
8328-8372 |
sentence |
denotes |
Dot lines represent gaps for the alignment. |
T5919 |
8329-8332 |
NN |
denotes |
Dot |
T5920 |
8333-8338 |
NNS |
denotes |
lines |
T5921 |
8339-8348 |
VBP |
denotes |
represent |
T5922 |
8349-8353 |
NNS |
denotes |
gaps |
T5923 |
8354-8357 |
IN |
denotes |
for |
T5924 |
8358-8361 |
DT |
denotes |
the |
T5925 |
8362-8371 |
NN |
denotes |
alignment |
T5926 |
8371-8372 |
. |
denotes |
. |
T6010 |
8383-8388 |
NN |
denotes |
Amino |
T6011 |
8389-8393 |
NN |
denotes |
acid |
T6013 |
8394-8402 |
NN |
denotes |
sequence |
T6012 |
8403-8412 |
NN |
denotes |
alignment |
T6014 |
8413-8420 |
VBG |
denotes |
showing |
T6015 |
8421-8424 |
DT |
denotes |
the |
T6016 |
8425-8437 |
NN |
denotes |
conservation |
T6017 |
8438-8440 |
IN |
denotes |
of |
T6018 |
8441-8444 |
NN |
denotes |
ACD |
T6019 |
8445-8451 |
NN |
denotes |
domain |
T6020 |
8452-8454 |
IN |
denotes |
in |
T6021 |
8455-8462 |
JJ |
denotes |
various |
T6022 |
8463-8470 |
NNS |
denotes |
species |
T6023 |
8470-8471 |
. |
denotes |
. |
T6024 |
8471-8533 |
sentence |
denotes |
Amip3 is a protein from Saccharomyces cerevisiae (NP_014581). |
T6025 |
8472-8477 |
NN |
denotes |
Amip3 |
T6026 |
8478-8480 |
VBZ |
denotes |
is |
T6027 |
8481-8482 |
DT |
denotes |
a |
T6028 |
8483-8490 |
NN |
denotes |
protein |
T6029 |
8491-8495 |
IN |
denotes |
from |
T6030 |
8496-8509 |
NNP |
denotes |
Saccharomyces |
T6031 |
8510-8520 |
NNP |
denotes |
cerevisiae |
T6032 |
8521-8522 |
-LRB- |
denotes |
( |
T6033 |
8522-8531 |
NN |
denotes |
NP_014581 |
T6034 |
8531-8532 |
-RRB- |
denotes |
) |
T6035 |
8532-8533 |
. |
denotes |
. |
T6036 |
8533-8585 |
sentence |
denotes |
CanG is a protein from Candida glabrata (AAF33142). |
T6037 |
8534-8538 |
NN |
denotes |
CanG |
T6038 |
8539-8541 |
VBZ |
denotes |
is |
T6039 |
8542-8543 |
DT |
denotes |
a |
T6040 |
8544-8551 |
NN |
denotes |
protein |
T6041 |
8552-8556 |
IN |
denotes |
from |
T6042 |
8557-8564 |
NNP |
denotes |
Candida |
T6043 |
8565-8573 |
NNP |
denotes |
glabrata |
T6044 |
8574-8575 |
-LRB- |
denotes |
( |
T6045 |
8575-8583 |
NN |
denotes |
AAF33142 |
T6046 |
8583-8584 |
-RRB- |
denotes |
) |
T6047 |
8584-8585 |
. |
denotes |
. |
T6048 |
8585-8651 |
sentence |
denotes |
NeuC (EAA31204) is a hypothetical protein from Neurospora crassa. |
T6049 |
8586-8590 |
NN |
denotes |
NeuC |
T6051 |
8591-8592 |
-LRB- |
denotes |
( |
T6052 |
8592-8600 |
NN |
denotes |
EAA31204 |
T6053 |
8600-8601 |
-RRB- |
denotes |
) |
T6050 |
8602-8604 |
VBZ |
denotes |
is |
T6054 |
8605-8606 |
DT |
denotes |
a |
T6056 |
8607-8619 |
JJ |
denotes |
hypothetical |
T6055 |
8620-8627 |
NN |
denotes |
protein |
T6057 |
8628-8632 |
IN |
denotes |
from |
T6058 |
8633-8643 |
NNP |
denotes |
Neurospora |
T6059 |
8644-8650 |
NNP |
denotes |
crassa |
T6060 |
8650-8651 |
. |
denotes |
. |
T6061 |
8651-8696 |
sentence |
denotes |
DroM is a gene product from D. melanogaster. |
T6062 |
8652-8656 |
NN |
denotes |
DroM |
T6063 |
8657-8659 |
VBZ |
denotes |
is |
T6064 |
8660-8661 |
DT |
denotes |
a |
T6066 |
8662-8666 |
NN |
denotes |
gene |
T6065 |
8667-8674 |
NN |
denotes |
product |
T6067 |
8675-8679 |
IN |
denotes |
from |
T6068 |
8680-8682 |
NNP |
denotes |
D. |
T6069 |
8683-8695 |
NNP |
denotes |
melanogaster |
T6070 |
8695-8696 |
. |
denotes |
. |
T6071 |
8696-8788 |
sentence |
denotes |
The accession number for this gene is CG40084 in BDGP (Berkeley Drosophila Genome Project). |
T6072 |
8697-8700 |
DT |
denotes |
The |
T6074 |
8701-8710 |
NN |
denotes |
accession |
T6073 |
8711-8717 |
NN |
denotes |
number |
T6076 |
8718-8721 |
IN |
denotes |
for |
T6077 |
8722-8726 |
DT |
denotes |
this |
T6078 |
8727-8731 |
NN |
denotes |
gene |
T6075 |
8732-8734 |
VBZ |
denotes |
is |
T6079 |
8735-8742 |
NN |
denotes |
CG40084 |
T6080 |
8743-8745 |
IN |
denotes |
in |
T6081 |
8746-8750 |
NN |
denotes |
BDGP |
T6082 |
8751-8752 |
-LRB- |
denotes |
( |
T6083 |
8752-8760 |
NNP |
denotes |
Berkeley |
T6085 |
8761-8771 |
NNP |
denotes |
Drosophila |
T6086 |
8772-8778 |
NNP |
denotes |
Genome |
T6084 |
8779-8786 |
NNP |
denotes |
Project |
T6087 |
8786-8787 |
-RRB- |
denotes |
) |
T6088 |
8787-8788 |
. |
denotes |
. |
T6089 |
8788-8858 |
sentence |
denotes |
AnoG represents a protein from the anopheles gambiae str. (EAA01004). |
T6090 |
8789-8793 |
NN |
denotes |
AnoG |
T6091 |
8794-8804 |
VBZ |
denotes |
represents |
T6092 |
8805-8806 |
DT |
denotes |
a |
T6093 |
8807-8814 |
NN |
denotes |
protein |
T6094 |
8815-8819 |
IN |
denotes |
from |
T6095 |
8820-8823 |
DT |
denotes |
the |
T6097 |
8824-8833 |
NNP |
denotes |
anopheles |
T6098 |
8834-8841 |
NNP |
denotes |
gambiae |
T6096 |
8842-8846 |
NN |
denotes |
str. |
T6099 |
8847-8848 |
-LRB- |
denotes |
( |
T6100 |
8848-8856 |
NN |
denotes |
EAA01004 |
T6101 |
8856-8857 |
-RRB- |
denotes |
) |
T6102 |
8857-8858 |
. |
denotes |
. |
T6103 |
8858-8932 |
sentence |
denotes |
CaeE (AAK77203) is a hypothetical protein from the Caenohabditis elegans. |
T6104 |
8859-8863 |
NN |
denotes |
CaeE |
T6106 |
8864-8865 |
-LRB- |
denotes |
( |
T6107 |
8865-8873 |
NN |
denotes |
AAK77203 |
T6108 |
8873-8874 |
-RRB- |
denotes |
) |
T6105 |
8875-8877 |
VBZ |
denotes |
is |
T6109 |
8878-8879 |
DT |
denotes |
a |
T6111 |
8880-8892 |
JJ |
denotes |
hypothetical |
T6110 |
8893-8900 |
NN |
denotes |
protein |
T6112 |
8901-8905 |
IN |
denotes |
from |
T6113 |
8906-8909 |
DT |
denotes |
the |
T6115 |
8910-8923 |
NNP |
denotes |
Caenohabditis |
T6114 |
8924-8931 |
NNP |
denotes |
elegans |
T6116 |
8931-8932 |
. |
denotes |
. |
T6117 |
8932-9025 |
sentence |
denotes |
CorC represents bacteria magnesium and cobalt efflux protein from the Shewanella oneidensis. |
T6118 |
8933-8937 |
NN |
denotes |
CorC |
T6119 |
8938-8948 |
VBZ |
denotes |
represents |
T6120 |
8949-8957 |
NNS |
denotes |
bacteria |
T6121 |
8958-8967 |
NN |
denotes |
magnesium |
T6122 |
8968-8971 |
CC |
denotes |
and |
T6123 |
8972-8978 |
NN |
denotes |
cobalt |
T6125 |
8979-8985 |
NN |
denotes |
efflux |
T6124 |
8986-8993 |
NN |
denotes |
protein |
T6126 |
8994-8998 |
IN |
denotes |
from |
T6127 |
8999-9002 |
DT |
denotes |
the |
T6129 |
9003-9013 |
NNP |
denotes |
Shewanella |
T6128 |
9014-9024 |
NNP |
denotes |
oneidensis |
T6130 |
9024-9025 |
. |
denotes |
. |
T6131 |
9025-9105 |
sentence |
denotes |
XyFD is a hypothetical protein from the Xylella fastidiosa Dixon (ZP_00038107). |
T6132 |
9026-9030 |
NN |
denotes |
XyFD |
T6133 |
9031-9033 |
VBZ |
denotes |
is |
T6134 |
9034-9035 |
DT |
denotes |
a |
T6136 |
9036-9048 |
JJ |
denotes |
hypothetical |
T6135 |
9049-9056 |
NN |
denotes |
protein |
T6137 |
9057-9061 |
IN |
denotes |
from |
T6138 |
9062-9065 |
DT |
denotes |
the |
T6140 |
9066-9073 |
NNP |
denotes |
Xylella |
T6141 |
9074-9084 |
NNP |
denotes |
fastidiosa |
T6139 |
9085-9090 |
NNP |
denotes |
Dixon |
T6142 |
9091-9092 |
-LRB- |
denotes |
( |
T6143 |
9092-9103 |
NN |
denotes |
ZP_00038107 |
T6144 |
9103-9104 |
-RRB- |
denotes |
) |
T6145 |
9104-9105 |
. |
denotes |
. |
T6153 |
9116-9128 |
JJ |
denotes |
Phylogenetic |
T6154 |
9129-9133 |
NN |
denotes |
tree |
T6155 |
9134-9141 |
VBG |
denotes |
showing |
T6156 |
9142-9155 |
NNS |
denotes |
relationships |
T6157 |
9156-9161 |
IN |
denotes |
among |
T6158 |
9162-9170 |
NN |
denotes |
proteins |
T6159 |
9171-9181 |
VBG |
denotes |
containing |
T6160 |
9182-9185 |
DT |
denotes |
the |
T6162 |
9186-9189 |
NN |
denotes |
ACD |
T6161 |
9190-9196 |
NN |
denotes |
domain |
T6163 |
9197-9201 |
IN |
denotes |
from |
T6164 |
9202-9208 |
NN |
denotes |
figure |
T6165 |
9209-9210 |
CD |
denotes |
2 |
T6166 |
9211-9214 |
CC |
denotes |
and |
T6167 |
9215-9216 |
CD |
denotes |
3 |
T6168 |
9216-9217 |
. |
denotes |
. |
T6169 |
9217-9330 |
sentence |
denotes |
The phylogenetic tree was constructed according to the calculation of the best match for the selected sequences. |
T6170 |
9218-9221 |
DT |
denotes |
The |
T6172 |
9222-9234 |
JJ |
denotes |
phylogenetic |
T6171 |
9235-9239 |
NN |
denotes |
tree |
T6174 |
9240-9243 |
VBD |
denotes |
was |
T6173 |
9244-9255 |
VBN |
denotes |
constructed |
T6175 |
9256-9265 |
VBG |
denotes |
according |
T6176 |
9266-9268 |
IN |
denotes |
to |
T6177 |
9269-9272 |
DT |
denotes |
the |
T6178 |
9273-9284 |
NN |
denotes |
calculation |
T6179 |
9285-9287 |
IN |
denotes |
of |
T6180 |
9288-9291 |
DT |
denotes |
the |
T6182 |
9292-9296 |
JJS |
denotes |
best |
T6181 |
9297-9302 |
NN |
denotes |
match |
T6183 |
9303-9306 |
IN |
denotes |
for |
T6184 |
9307-9310 |
DT |
denotes |
the |
T6186 |
9311-9319 |
JJ |
denotes |
selected |
T6185 |
9320-9329 |
NNS |
denotes |
sequences |
T6187 |
9329-9330 |
. |
denotes |
. |
T6188 |
9330-9400 |
sentence |
denotes |
Abbreviations for each protein are the same as presented in figure 3. |
T6189 |
9331-9344 |
NNS |
denotes |
Abbreviations |
T6191 |
9345-9348 |
IN |
denotes |
for |
T6192 |
9349-9353 |
DT |
denotes |
each |
T6193 |
9354-9361 |
NN |
denotes |
protein |
T6190 |
9362-9365 |
VBP |
denotes |
are |
T6194 |
9366-9369 |
DT |
denotes |
the |
T6195 |
9370-9374 |
JJ |
denotes |
same |
T6196 |
9375-9377 |
IN |
denotes |
as |
T6197 |
9378-9387 |
VBN |
denotes |
presented |
T6198 |
9388-9390 |
IN |
denotes |
in |
T6199 |
9391-9397 |
NN |
denotes |
figure |
T6200 |
9398-9399 |
CD |
denotes |
3 |
T6201 |
9399-9400 |
. |
denotes |
. |
T2376 |
9401-9403 |
PRP |
denotes |
We |
T2375 |
9401-9584 |
sentence |
denotes |
We found that all mouse Acdp members contain four distinct transmembrane domains (Fig. 5), two CBS domains and a DUF21 domain that are found in bacteria CorC and yeast Amip3 proteins. |
T2377 |
9404-9409 |
VBD |
denotes |
found |
T2378 |
9410-9414 |
IN |
denotes |
that |
T2380 |
9415-9418 |
DT |
denotes |
all |
T2382 |
9419-9424 |
NN |
denotes |
mouse |
T2383 |
9425-9429 |
NN |
denotes |
Acdp |
T2381 |
9430-9437 |
NNS |
denotes |
members |
T2379 |
9438-9445 |
VBP |
denotes |
contain |
T2384 |
9446-9450 |
CD |
denotes |
four |
T2386 |
9451-9459 |
JJ |
denotes |
distinct |
T2387 |
9460-9473 |
NN |
denotes |
transmembrane |
T2385 |
9474-9481 |
NNS |
denotes |
domains |
T2388 |
9482-9483 |
-LRB- |
denotes |
( |
T2389 |
9483-9487 |
NN |
denotes |
Fig. |
T2390 |
9488-9489 |
CD |
denotes |
5 |
T2391 |
9489-9490 |
-RRB- |
denotes |
) |
T2392 |
9490-9492 |
, |
denotes |
, |
T2393 |
9492-9495 |
CD |
denotes |
two |
T2395 |
9496-9499 |
NN |
denotes |
CBS |
T2394 |
9500-9507 |
NNS |
denotes |
domains |
T2396 |
9508-9511 |
CC |
denotes |
and |
T2397 |
9512-9513 |
DT |
denotes |
a |
T2399 |
9514-9519 |
NN |
denotes |
DUF21 |
T2398 |
9520-9526 |
NN |
denotes |
domain |
T2400 |
9527-9531 |
WDT |
denotes |
that |
T2402 |
9532-9535 |
VBP |
denotes |
are |
T2401 |
9536-9541 |
VBN |
denotes |
found |
T2403 |
9542-9544 |
IN |
denotes |
in |
T2404 |
9545-9553 |
NNS |
denotes |
bacteria |
T2405 |
9554-9558 |
NN |
denotes |
CorC |
T2407 |
9559-9562 |
CC |
denotes |
and |
T2408 |
9563-9568 |
NN |
denotes |
yeast |
T2409 |
9569-9574 |
NN |
denotes |
Amip3 |
T2406 |
9575-9583 |
NN |
denotes |
proteins |
T2410 |
9583-9584 |
. |
denotes |
. |
T2411 |
9584-9688 |
sentence |
denotes |
CBS domains are small intracellular modules that are mostly found in 2 or four copies within a protein. |
T2412 |
9585-9588 |
NN |
denotes |
CBS |
T2413 |
9589-9596 |
NNS |
denotes |
domains |
T2414 |
9597-9600 |
VBP |
denotes |
are |
T2415 |
9601-9606 |
JJ |
denotes |
small |
T2417 |
9607-9620 |
JJ |
denotes |
intracellular |
T2416 |
9621-9628 |
NNS |
denotes |
modules |
T2418 |
9629-9633 |
WDT |
denotes |
that |
T2420 |
9634-9637 |
VBP |
denotes |
are |
T2421 |
9638-9644 |
RB |
denotes |
mostly |
T2419 |
9645-9650 |
VBN |
denotes |
found |
T2422 |
9651-9653 |
IN |
denotes |
in |
T2423 |
9654-9655 |
CD |
denotes |
2 |
T2425 |
9656-9658 |
CC |
denotes |
or |
T2426 |
9659-9663 |
CD |
denotes |
four |
T2424 |
9664-9670 |
NNS |
denotes |
copies |
T2427 |
9671-9677 |
IN |
denotes |
within |
T2428 |
9678-9679 |
DT |
denotes |
a |
T2429 |
9680-9687 |
NN |
denotes |
protein |
T2430 |
9687-9688 |
. |
denotes |
. |
T2431 |
9688-9756 |
sentence |
denotes |
Pairs of CBS domains dimerise to form a stable globular domain [8]. |
T2432 |
9689-9694 |
NNS |
denotes |
Pairs |
T2434 |
9695-9697 |
IN |
denotes |
of |
T2435 |
9698-9701 |
NN |
denotes |
CBS |
T2436 |
9702-9709 |
NNS |
denotes |
domains |
T2433 |
9710-9718 |
VBP |
denotes |
dimerise |
T2437 |
9719-9721 |
TO |
denotes |
to |
T2438 |
9722-9726 |
VB |
denotes |
form |
T2439 |
9727-9728 |
DT |
denotes |
a |
T2441 |
9729-9735 |
JJ |
denotes |
stable |
T2442 |
9736-9744 |
JJ |
denotes |
globular |
T2440 |
9745-9751 |
NN |
denotes |
domain |
T2443 |
9752-9753 |
-LRB- |
denotes |
[ |
T2444 |
9753-9754 |
CD |
denotes |
8 |
T2445 |
9754-9755 |
-RRB- |
denotes |
] |
T2446 |
9755-9756 |
. |
denotes |
. |
T2447 |
9756-9829 |
sentence |
denotes |
DUF21 (CD: pfam01959.9) is a newly defined domain with unknown function. |
T2448 |
9757-9762 |
NN |
denotes |
DUF21 |
T2450 |
9763-9764 |
-LRB- |
denotes |
( |
T2452 |
9764-9766 |
NN |
denotes |
CD |
T2453 |
9766-9768 |
: |
denotes |
: |
T2451 |
9768-9779 |
NN |
denotes |
pfam01959.9 |
T2454 |
9779-9780 |
-RRB- |
denotes |
) |
T2449 |
9781-9783 |
VBZ |
denotes |
is |
T2455 |
9784-9785 |
DT |
denotes |
a |
T2457 |
9786-9791 |
RB |
denotes |
newly |
T2458 |
9792-9799 |
VBN |
denotes |
defined |
T2456 |
9800-9806 |
NN |
denotes |
domain |
T2459 |
9807-9811 |
IN |
denotes |
with |
T2460 |
9812-9819 |
JJ |
denotes |
unknown |
T2461 |
9820-9828 |
NN |
denotes |
function |
T2462 |
9828-9829 |
. |
denotes |
. |
T2463 |
9829-9969 |
sentence |
denotes |
This domain is a transmembrane region and found to be located in the N-terminus of the proteins adjacent to two intracellular CBS domains . |
T2464 |
9830-9834 |
DT |
denotes |
This |
T2465 |
9835-9841 |
NN |
denotes |
domain |
T2466 |
9842-9844 |
VBZ |
denotes |
is |
T2467 |
9845-9846 |
DT |
denotes |
a |
T2469 |
9847-9860 |
JJ |
denotes |
transmembrane |
T2468 |
9861-9867 |
NN |
denotes |
region |
T2470 |
9868-9871 |
CC |
denotes |
and |
T2471 |
9872-9877 |
VBN |
denotes |
found |
T2472 |
9878-9880 |
TO |
denotes |
to |
T2474 |
9881-9883 |
VB |
denotes |
be |
T2473 |
9884-9891 |
VBN |
denotes |
located |
T2475 |
9892-9894 |
IN |
denotes |
in |
T2476 |
9895-9898 |
DT |
denotes |
the |
T2478 |
9899-9900 |
NN |
denotes |
N |
T2479 |
9900-9901 |
HYPH |
denotes |
- |
T2477 |
9901-9909 |
NN |
denotes |
terminus |
T2480 |
9910-9912 |
IN |
denotes |
of |
T2481 |
9913-9916 |
DT |
denotes |
the |
T2482 |
9917-9925 |
NN |
denotes |
proteins |
T2483 |
9926-9934 |
JJ |
denotes |
adjacent |
T2484 |
9935-9937 |
IN |
denotes |
to |
T2485 |
9938-9941 |
CD |
denotes |
two |
T2487 |
9942-9955 |
JJ |
denotes |
intracellular |
T2488 |
9956-9959 |
NN |
denotes |
CBS |
T2486 |
9960-9967 |
NNS |
denotes |
domains |
T2489 |
9968-9969 |
. |
denotes |
. |
T2490 |
9969-10071 |
sentence |
denotes |
A cNMP-binding domain (cyclic nucleotide-monophosphate-binding domain) was found in all Acdp members. |
T2491 |
9970-9971 |
DT |
denotes |
A |
T2493 |
9972-9976 |
NN |
denotes |
cNMP |
T2495 |
9976-9977 |
HYPH |
denotes |
- |
T2494 |
9977-9984 |
VBG |
denotes |
binding |
T2492 |
9985-9991 |
NN |
denotes |
domain |
T2497 |
9992-9993 |
-LRB- |
denotes |
( |
T2499 |
9993-9999 |
JJ |
denotes |
cyclic |
T2501 |
10000-10010 |
NN |
denotes |
nucleotide |
T2502 |
10010-10011 |
HYPH |
denotes |
- |
T2500 |
10011-10024 |
NN |
denotes |
monophosphate |
T2503 |
10024-10025 |
HYPH |
denotes |
- |
T2504 |
10025-10032 |
VBG |
denotes |
binding |
T2498 |
10033-10039 |
NN |
denotes |
domain |
T2505 |
10039-10040 |
-RRB- |
denotes |
) |
T2506 |
10041-10044 |
VBD |
denotes |
was |
T2496 |
10045-10050 |
VBN |
denotes |
found |
T2507 |
10051-10053 |
IN |
denotes |
in |
T2508 |
10054-10057 |
DT |
denotes |
all |
T2510 |
10058-10062 |
NN |
denotes |
Acdp |
T2509 |
10063-10070 |
NNS |
denotes |
members |
T2511 |
10070-10071 |
. |
denotes |
. |
T2512 |
10071-10798 |
sentence |
denotes |
Figure 5 Four transmembrane domains within Acdp4 protein. Transmembrane domains were predicted by the TMHMM program . The plot shows the posterior probabilities of inside /outside/TM helix. At the top of the plot (between 1 and 1.2) the N-best prediction is shown. The plot is obtained by calculating the total probability that a residue sits in helix, inside, or outside summed over all possible paths through the model. In addition, Acdp1 contains an Alanine-rich region (2–10: AAAAAAAAA), a Leucine-rich region (204–257: LLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALF SGLRLSLLSLDPVELRVL), a Proline-rich region (78–130: PGPPVPAAPVPAPSLA PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP), and two amidation sites (917–920: MGKK; 926–929: SGRK). |
T6228 |
10082-10086 |
CD |
denotes |
Four |
T6230 |
10087-10100 |
NN |
denotes |
transmembrane |
T6229 |
10101-10108 |
NNS |
denotes |
domains |
T6231 |
10109-10115 |
IN |
denotes |
within |
T6232 |
10116-10121 |
NN |
denotes |
Acdp4 |
T6233 |
10122-10129 |
NN |
denotes |
protein |
T6234 |
10129-10130 |
. |
denotes |
. |
T6235 |
10130-10190 |
sentence |
denotes |
Transmembrane domains were predicted by the TMHMM program . |
T6236 |
10131-10144 |
NN |
denotes |
Transmembrane |
T6237 |
10145-10152 |
NNS |
denotes |
domains |
T6239 |
10153-10157 |
VBD |
denotes |
were |
T6238 |
10158-10167 |
VBN |
denotes |
predicted |
T6240 |
10168-10170 |
IN |
denotes |
by |
T6241 |
10171-10174 |
DT |
denotes |
the |
T6243 |
10175-10180 |
NN |
denotes |
TMHMM |
T6242 |
10181-10188 |
NN |
denotes |
program |
T6244 |
10189-10190 |
. |
denotes |
. |
T6245 |
10190-10262 |
sentence |
denotes |
The plot shows the posterior probabilities of inside /outside/TM helix. |
T6246 |
10191-10194 |
DT |
denotes |
The |
T6247 |
10195-10199 |
NN |
denotes |
plot |
T6248 |
10200-10205 |
VBZ |
denotes |
shows |
T6249 |
10206-10209 |
DT |
denotes |
the |
T6251 |
10210-10219 |
JJ |
denotes |
posterior |
T6250 |
10220-10233 |
NNS |
denotes |
probabilities |
T6252 |
10234-10236 |
IN |
denotes |
of |
T6253 |
10237-10243 |
JJ |
denotes |
inside |
T6255 |
10244-10245 |
HYPH |
denotes |
/ |
T6256 |
10245-10252 |
JJ |
denotes |
outside |
T6257 |
10252-10253 |
HYPH |
denotes |
/ |
T6254 |
10253-10255 |
NN |
denotes |
TM |
T6258 |
10256-10261 |
NN |
denotes |
helix |
T6259 |
10261-10262 |
. |
denotes |
. |
T6260 |
10262-10337 |
sentence |
denotes |
At the top of the plot (between 1 and 1.2) the N-best prediction is shown. |
T6261 |
10263-10265 |
IN |
denotes |
At |
T6263 |
10266-10269 |
DT |
denotes |
the |
T6264 |
10270-10273 |
NN |
denotes |
top |
T6265 |
10274-10276 |
IN |
denotes |
of |
T6266 |
10277-10280 |
DT |
denotes |
the |
T6267 |
10281-10285 |
NN |
denotes |
plot |
T6268 |
10286-10287 |
-LRB- |
denotes |
( |
T6269 |
10287-10294 |
IN |
denotes |
between |
T6270 |
10295-10296 |
CD |
denotes |
1 |
T6271 |
10297-10300 |
CC |
denotes |
and |
T6272 |
10301-10304 |
CD |
denotes |
1.2 |
T6273 |
10304-10305 |
-RRB- |
denotes |
) |
T6274 |
10306-10309 |
DT |
denotes |
the |
T6276 |
10310-10311 |
NN |
denotes |
N |
T6278 |
10311-10312 |
HYPH |
denotes |
- |
T6277 |
10312-10316 |
JJS |
denotes |
best |
T6275 |
10317-10327 |
NN |
denotes |
prediction |
T6279 |
10328-10330 |
VBZ |
denotes |
is |
T6262 |
10331-10336 |
VBN |
denotes |
shown |
T6280 |
10336-10337 |
. |
denotes |
. |
T6281 |
10337-10494 |
sentence |
denotes |
The plot is obtained by calculating the total probability that a residue sits in helix, inside, or outside summed over all possible paths through the model. |
T6282 |
10338-10341 |
DT |
denotes |
The |
T6283 |
10342-10346 |
NN |
denotes |
plot |
T6285 |
10347-10349 |
VBZ |
denotes |
is |
T6284 |
10350-10358 |
VBN |
denotes |
obtained |
T6286 |
10359-10361 |
IN |
denotes |
by |
T6287 |
10362-10373 |
VBG |
denotes |
calculating |
T6288 |
10374-10377 |
DT |
denotes |
the |
T6290 |
10378-10383 |
JJ |
denotes |
total |
T6289 |
10384-10395 |
NN |
denotes |
probability |
T6291 |
10396-10400 |
IN |
denotes |
that |
T6293 |
10401-10402 |
DT |
denotes |
a |
T6294 |
10403-10410 |
NN |
denotes |
residue |
T6292 |
10411-10415 |
VBZ |
denotes |
sits |
T6295 |
10416-10418 |
IN |
denotes |
in |
T6296 |
10419-10424 |
NN |
denotes |
helix |
T6297 |
10424-10426 |
, |
denotes |
, |
T6298 |
10426-10432 |
RB |
denotes |
inside |
T6299 |
10432-10434 |
, |
denotes |
, |
T6300 |
10434-10436 |
CC |
denotes |
or |
T6301 |
10437-10444 |
RB |
denotes |
outside |
T6302 |
10445-10451 |
VBD |
denotes |
summed |
T6303 |
10452-10456 |
IN |
denotes |
over |
T6304 |
10457-10460 |
DT |
denotes |
all |
T6306 |
10461-10469 |
JJ |
denotes |
possible |
T6305 |
10470-10475 |
NNS |
denotes |
paths |
T6307 |
10476-10483 |
IN |
denotes |
through |
T6308 |
10484-10487 |
DT |
denotes |
the |
T6309 |
10488-10493 |
NN |
denotes |
model |
T6310 |
10493-10494 |
. |
denotes |
. |
T2513 |
10495-10497 |
IN |
denotes |
In |
T2515 |
10498-10506 |
NN |
denotes |
addition |
T2516 |
10506-10508 |
, |
denotes |
, |
T2517 |
10508-10513 |
NN |
denotes |
Acdp1 |
T2514 |
10514-10522 |
VBZ |
denotes |
contains |
T2518 |
10523-10525 |
DT |
denotes |
an |
T2520 |
10526-10533 |
NN |
denotes |
Alanine |
T2522 |
10533-10534 |
HYPH |
denotes |
- |
T2521 |
10534-10538 |
JJ |
denotes |
rich |
T2519 |
10539-10545 |
NN |
denotes |
region |
T2523 |
10546-10547 |
-LRB- |
denotes |
( |
T2525 |
10547-10548 |
CD |
denotes |
2 |
T2526 |
10548-10549 |
SYM |
denotes |
– |
T2527 |
10549-10551 |
CD |
denotes |
10 |
T2528 |
10551-10553 |
: |
denotes |
: |
T2524 |
10553-10562 |
NN |
denotes |
AAAAAAAAA |
T2529 |
10562-10563 |
-RRB- |
denotes |
) |
T2530 |
10563-10565 |
, |
denotes |
, |
T2531 |
10565-10566 |
DT |
denotes |
a |
T2533 |
10567-10574 |
NN |
denotes |
Leucine |
T2535 |
10574-10575 |
HYPH |
denotes |
- |
T2534 |
10575-10579 |
JJ |
denotes |
rich |
T2532 |
10580-10586 |
NN |
denotes |
region |
T2536 |
10587-10588 |
-LRB- |
denotes |
( |
T2538 |
10588-10591 |
CD |
denotes |
204 |
T2539 |
10591-10592 |
SYM |
denotes |
– |
T2540 |
10592-10595 |
CD |
denotes |
257 |
T2541 |
10595-10597 |
: |
denotes |
: |
T2542 |
10597-10633 |
NN |
denotes |
LLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALF |
T2537 |
10634-10652 |
NN |
denotes |
SGLRLSLLSLDPVELRVL |
T2543 |
10652-10653 |
-RRB- |
denotes |
) |
T2544 |
10653-10655 |
, |
denotes |
, |
T2545 |
10655-10656 |
DT |
denotes |
a |
T2547 |
10657-10664 |
NN |
denotes |
Proline |
T2549 |
10664-10665 |
HYPH |
denotes |
- |
T2548 |
10665-10669 |
JJ |
denotes |
rich |
T2546 |
10670-10676 |
NN |
denotes |
region |
T2550 |
10677-10678 |
-LRB- |
denotes |
( |
T2552 |
10678-10680 |
CD |
denotes |
78 |
T2553 |
10680-10681 |
SYM |
denotes |
– |
T2554 |
10681-10684 |
CD |
denotes |
130 |
T2555 |
10684-10686 |
: |
denotes |
: |
T2556 |
10686-10702 |
NN |
denotes |
PGPPVPAAPVPAPSLA |
T2551 |
10703-10740 |
NN |
denotes |
PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
T2557 |
10740-10741 |
-RRB- |
denotes |
) |
T2558 |
10741-10743 |
, |
denotes |
, |
T2559 |
10743-10746 |
CC |
denotes |
and |
T2560 |
10747-10750 |
CD |
denotes |
two |
T2562 |
10751-10760 |
NN |
denotes |
amidation |
T2561 |
10761-10766 |
NNS |
denotes |
sites |
T2563 |
10767-10768 |
-LRB- |
denotes |
( |
T2565 |
10768-10771 |
CD |
denotes |
917 |
T2567 |
10771-10772 |
SYM |
denotes |
– |
T2568 |
10772-10775 |
CD |
denotes |
920 |
T2569 |
10775-10777 |
: |
denotes |
: |
T2566 |
10777-10781 |
NN |
denotes |
MGKK |
T2570 |
10781-10782 |
: |
denotes |
; |
T2571 |
10783-10786 |
CD |
denotes |
926 |
T2572 |
10786-10787 |
SYM |
denotes |
– |
T2573 |
10787-10790 |
CD |
denotes |
929 |
T2574 |
10790-10792 |
: |
denotes |
: |
T2564 |
10792-10796 |
NN |
denotes |
SGRK |
T2575 |
10796-10797 |
-RRB- |
denotes |
) |
T2576 |
10797-10798 |
. |
denotes |
. |
T2577 |
10798-10865 |
sentence |
denotes |
Acdp2 has a glycine-rich region (201–222: GAGGSGSASGTVGGKGGAGVAG). |
T2578 |
10799-10804 |
NN |
denotes |
Acdp2 |
T2579 |
10805-10808 |
VBZ |
denotes |
has |
T2580 |
10809-10810 |
DT |
denotes |
a |
T2582 |
10811-10818 |
NN |
denotes |
glycine |
T2584 |
10818-10819 |
HYPH |
denotes |
- |
T2583 |
10819-10823 |
JJ |
denotes |
rich |
T2581 |
10824-10830 |
NN |
denotes |
region |
T2585 |
10831-10832 |
-LRB- |
denotes |
( |
T2587 |
10832-10835 |
CD |
denotes |
201 |
T2588 |
10835-10836 |
SYM |
denotes |
– |
T2589 |
10836-10839 |
CD |
denotes |
222 |
T2590 |
10839-10841 |
: |
denotes |
: |
T2586 |
10841-10863 |
NN |
denotes |
GAGGSGSASGTVGGKGGAGVAG |
T2591 |
10863-10864 |
-RRB- |
denotes |
) |
T2592 |
10864-10865 |
. |
denotes |
. |
T2593 |
10865-10960 |
sentence |
denotes |
Acdp3 possesses a large alanine-rich region (2–261) and a large leucine-rich region (201–299). |
T2594 |
10866-10871 |
NN |
denotes |
Acdp3 |
T2595 |
10872-10881 |
VBZ |
denotes |
possesses |
T2596 |
10882-10883 |
DT |
denotes |
a |
T2598 |
10884-10889 |
JJ |
denotes |
large |
T2599 |
10890-10897 |
NN |
denotes |
alanine |
T2601 |
10897-10898 |
HYPH |
denotes |
- |
T2600 |
10898-10902 |
JJ |
denotes |
rich |
T2597 |
10903-10909 |
NN |
denotes |
region |
T2602 |
10910-10911 |
-LRB- |
denotes |
( |
T2603 |
10911-10912 |
CD |
denotes |
2 |
T2604 |
10912-10913 |
SYM |
denotes |
– |
T2605 |
10913-10916 |
CD |
denotes |
261 |
T2606 |
10916-10917 |
-RRB- |
denotes |
) |
T2607 |
10918-10921 |
CC |
denotes |
and |
T2608 |
10922-10923 |
DT |
denotes |
a |
T2610 |
10924-10929 |
JJ |
denotes |
large |
T2611 |
10930-10937 |
NN |
denotes |
leucine |
T2613 |
10937-10938 |
HYPH |
denotes |
- |
T2612 |
10938-10942 |
JJ |
denotes |
rich |
T2609 |
10943-10949 |
NN |
denotes |
region |
T2614 |
10950-10951 |
-LRB- |
denotes |
( |
T2615 |
10951-10954 |
CD |
denotes |
201 |
T2616 |
10954-10955 |
SYM |
denotes |
– |
T2617 |
10955-10958 |
CD |
denotes |
299 |
T2618 |
10958-10959 |
-RRB- |
denotes |
) |
T2619 |
10959-10960 |
. |
denotes |
. |
T2620 |
10960-11070 |
sentence |
denotes |
Acdp4 contains a leucine zipper pattern (185–206: LVMVLLVLSGIFSGLNLGLMAL) and an amidation site (7–10: GGRR). |
T2621 |
10961-10966 |
NN |
denotes |
Acdp4 |
T2622 |
10967-10975 |
VBZ |
denotes |
contains |
T2623 |
10976-10977 |
DT |
denotes |
a |
T2625 |
10978-10985 |
NN |
denotes |
leucine |
T2626 |
10986-10992 |
NN |
denotes |
zipper |
T2624 |
10993-11000 |
NN |
denotes |
pattern |
T2627 |
11001-11002 |
-LRB- |
denotes |
( |
T2629 |
11002-11005 |
CD |
denotes |
185 |
T2630 |
11005-11006 |
SYM |
denotes |
– |
T2631 |
11006-11009 |
CD |
denotes |
206 |
T2632 |
11009-11011 |
: |
denotes |
: |
T2628 |
11011-11033 |
NN |
denotes |
LVMVLLVLSGIFSGLNLGLMAL |
T2633 |
11033-11034 |
-RRB- |
denotes |
) |
T2634 |
11035-11038 |
CC |
denotes |
and |
T2635 |
11039-11041 |
DT |
denotes |
an |
T2637 |
11042-11051 |
NN |
denotes |
amidation |
T2636 |
11052-11056 |
NN |
denotes |
site |
T2638 |
11057-11058 |
-LRB- |
denotes |
( |
T2640 |
11058-11059 |
CD |
denotes |
7 |
T2641 |
11059-11060 |
SYM |
denotes |
– |
T2642 |
11060-11062 |
CD |
denotes |
10 |
T2643 |
11062-11064 |
: |
denotes |
: |
T2639 |
11064-11068 |
NN |
denotes |
GGRR |
T2644 |
11068-11069 |
-RRB- |
denotes |
) |
T2645 |
11069-11070 |
. |
denotes |
. |
T2862 |
11072-11080 |
NN |
denotes |
Antibody |
T2863 |
11081-11091 |
NN |
denotes |
production |
T2864 |
11091-11093 |
, |
denotes |
, |
T2865 |
11093-11100 |
NNP |
denotes |
Western |
T2866 |
11101-11108 |
NNS |
denotes |
results |
T2867 |
11109-11112 |
CC |
denotes |
and |
T2868 |
11113-11124 |
JJ |
denotes |
subcellular |
T2869 |
11125-11137 |
NN |
denotes |
localization |
T2870 |
11137-11345 |
sentence |
denotes |
Peptides from Acdp1 N- (TSFLLRVYFQPGPPATAAPVPSPT) and C- (TQQLTLSPAAVPTR) terminuses, conserved peptide from ACD domain of Acdp1 (HNIVDILFVKDLAFVDPDDCTPLLTVTRF) were commercially synthesized (Sigma Genosys). |
T2871 |
11138-11146 |
NNS |
denotes |
Peptides |
T2873 |
11147-11151 |
IN |
denotes |
from |
T2874 |
11152-11157 |
NN |
denotes |
Acdp1 |
T2876 |
11158-11159 |
NN |
denotes |
N |
T2877 |
11159-11160 |
HYPH |
denotes |
- |
T2878 |
11161-11162 |
-LRB- |
denotes |
( |
T2879 |
11162-11186 |
NN |
denotes |
TSFLLRVYFQPGPPATAAPVPSPT |
T2880 |
11186-11187 |
-RRB- |
denotes |
) |
T2881 |
11188-11191 |
CC |
denotes |
and |
T2882 |
11192-11193 |
NN |
denotes |
C |
T2883 |
11193-11194 |
HYPH |
denotes |
- |
T2884 |
11195-11196 |
-LRB- |
denotes |
( |
T2885 |
11196-11210 |
NN |
denotes |
TQQLTLSPAAVPTR |
T2886 |
11210-11211 |
-RRB- |
denotes |
) |
T2875 |
11212-11222 |
NNS |
denotes |
terminuses |
T2887 |
11222-11224 |
, |
denotes |
, |
T2888 |
11224-11233 |
JJ |
denotes |
conserved |
T2889 |
11234-11241 |
NN |
denotes |
peptide |
T2890 |
11242-11246 |
IN |
denotes |
from |
T2891 |
11247-11250 |
NN |
denotes |
ACD |
T2892 |
11251-11257 |
NN |
denotes |
domain |
T2893 |
11258-11260 |
IN |
denotes |
of |
T2894 |
11261-11266 |
NN |
denotes |
Acdp1 |
T2895 |
11267-11268 |
-LRB- |
denotes |
( |
T2896 |
11268-11297 |
NN |
denotes |
HNIVDILFVKDLAFVDPDDCTPLLTVTRF |
T2897 |
11297-11298 |
-RRB- |
denotes |
) |
T2898 |
11299-11303 |
VBD |
denotes |
were |
T2899 |
11304-11316 |
RB |
denotes |
commercially |
T2872 |
11317-11328 |
VBN |
denotes |
synthesized |
T2900 |
11329-11330 |
-LRB- |
denotes |
( |
T2902 |
11330-11335 |
NNP |
denotes |
Sigma |
T2901 |
11336-11343 |
NNP |
denotes |
Genosys |
T2903 |
11343-11344 |
-RRB- |
denotes |
) |
T2904 |
11344-11345 |
. |
denotes |
. |
T2905 |
11345-11493 |
sentence |
denotes |
These antigenic sites were predicted by software from Sigma Genosys and polyclonal antibodies for each peptide were produced by immunizing rabbits. |
T2906 |
11346-11351 |
DT |
denotes |
These |
T2908 |
11352-11361 |
JJ |
denotes |
antigenic |
T2907 |
11362-11367 |
NNS |
denotes |
sites |
T2910 |
11368-11372 |
VBD |
denotes |
were |
T2909 |
11373-11382 |
VBN |
denotes |
predicted |
T2911 |
11383-11385 |
IN |
denotes |
by |
T2912 |
11386-11394 |
NN |
denotes |
software |
T2913 |
11395-11399 |
IN |
denotes |
from |
T2914 |
11400-11405 |
NNP |
denotes |
Sigma |
T2915 |
11406-11413 |
NNP |
denotes |
Genosys |
T2916 |
11414-11417 |
CC |
denotes |
and |
T2917 |
11418-11428 |
JJ |
denotes |
polyclonal |
T2918 |
11429-11439 |
NNS |
denotes |
antibodies |
T2920 |
11440-11443 |
IN |
denotes |
for |
T2921 |
11444-11448 |
DT |
denotes |
each |
T2922 |
11449-11456 |
NN |
denotes |
peptide |
T2923 |
11457-11461 |
VBD |
denotes |
were |
T2919 |
11462-11470 |
VBN |
denotes |
produced |
T2924 |
11471-11473 |
IN |
denotes |
by |
T2925 |
11474-11484 |
VBG |
denotes |
immunizing |
T2926 |
11485-11492 |
NNS |
denotes |
rabbits |
T2927 |
11492-11493 |
. |
denotes |
. |
T2928 |
11493-11603 |
sentence |
denotes |
To test the specificity of the antibodies, we conducted Western-blot analysis of mouse brain tissue extracts. |
T2929 |
11494-11496 |
TO |
denotes |
To |
T2930 |
11497-11501 |
VB |
denotes |
test |
T2932 |
11502-11505 |
DT |
denotes |
the |
T2933 |
11506-11517 |
NN |
denotes |
specificity |
T2934 |
11518-11520 |
IN |
denotes |
of |
T2935 |
11521-11524 |
DT |
denotes |
the |
T2936 |
11525-11535 |
NNS |
denotes |
antibodies |
T2937 |
11535-11537 |
, |
denotes |
, |
T2938 |
11537-11539 |
PRP |
denotes |
we |
T2931 |
11540-11549 |
VBD |
denotes |
conducted |
T2939 |
11550-11557 |
NNP |
denotes |
Western |
T2941 |
11557-11558 |
HYPH |
denotes |
- |
T2940 |
11558-11562 |
NN |
denotes |
blot |
T2942 |
11563-11571 |
NN |
denotes |
analysis |
T2943 |
11572-11574 |
IN |
denotes |
of |
T2944 |
11575-11580 |
NN |
denotes |
mouse |
T2945 |
11581-11586 |
NN |
denotes |
brain |
T2946 |
11587-11593 |
NN |
denotes |
tissue |
T2947 |
11594-11602 |
NNS |
denotes |
extracts |
T2948 |
11602-11603 |
. |
denotes |
. |
T2949 |
11603-11706 |
sentence |
denotes |
As shown in Fig. 6A, the antibody produced by C-terminal peptide specifically detected Acdp1 (lane 3). |
T2950 |
11604-11606 |
IN |
denotes |
As |
T2951 |
11607-11612 |
VBN |
denotes |
shown |
T2953 |
11613-11615 |
IN |
denotes |
in |
T2954 |
11616-11620 |
NN |
denotes |
Fig. |
T2955 |
11621-11623 |
CD |
denotes |
6A |
T2956 |
11623-11625 |
, |
denotes |
, |
T2957 |
11625-11628 |
DT |
denotes |
the |
T2958 |
11629-11637 |
NN |
denotes |
antibody |
T2959 |
11638-11646 |
VBN |
denotes |
produced |
T2960 |
11647-11649 |
IN |
denotes |
by |
T2961 |
11650-11651 |
NN |
denotes |
C |
T2963 |
11651-11652 |
HYPH |
denotes |
- |
T2964 |
11652-11660 |
JJ |
denotes |
terminal |
T2962 |
11661-11668 |
NN |
denotes |
peptide |
T2965 |
11669-11681 |
RB |
denotes |
specifically |
T2952 |
11682-11690 |
VBD |
denotes |
detected |
T2966 |
11691-11696 |
NN |
denotes |
Acdp1 |
T2967 |
11697-11698 |
-LRB- |
denotes |
( |
T2968 |
11698-11702 |
NN |
denotes |
lane |
T2969 |
11703-11704 |
CD |
denotes |
3 |
T2970 |
11704-11705 |
-RRB- |
denotes |
) |
T2971 |
11705-11706 |
. |
denotes |
. |
T2972 |
11706-11868 |
sentence |
denotes |
The antibody generated by N-terminal peptide recognized Acdp4 in addition to Acdp1, although the reactivity to latter was significantly higher (Fig. 6A, lane 2). |
T2973 |
11707-11710 |
DT |
denotes |
The |
T2974 |
11711-11719 |
NN |
denotes |
antibody |
T2976 |
11720-11729 |
VBN |
denotes |
generated |
T2977 |
11730-11732 |
IN |
denotes |
by |
T2978 |
11733-11734 |
NN |
denotes |
N |
T2980 |
11734-11735 |
HYPH |
denotes |
- |
T2981 |
11735-11743 |
JJ |
denotes |
terminal |
T2979 |
11744-11751 |
NN |
denotes |
peptide |
T2975 |
11752-11762 |
VBD |
denotes |
recognized |
T2982 |
11763-11768 |
NN |
denotes |
Acdp4 |
T2983 |
11769-11771 |
IN |
denotes |
in |
T2984 |
11772-11780 |
NN |
denotes |
addition |
T2985 |
11781-11783 |
IN |
denotes |
to |
T2986 |
11784-11789 |
NN |
denotes |
Acdp1 |
T2987 |
11789-11791 |
, |
denotes |
, |
T2988 |
11791-11799 |
IN |
denotes |
although |
T2990 |
11800-11803 |
DT |
denotes |
the |
T2991 |
11804-11814 |
NN |
denotes |
reactivity |
T2992 |
11815-11817 |
IN |
denotes |
to |
T2993 |
11818-11824 |
NN |
denotes |
latter |
T2989 |
11825-11828 |
VBD |
denotes |
was |
T2994 |
11829-11842 |
RB |
denotes |
significantly |
T2995 |
11843-11849 |
JJR |
denotes |
higher |
T2996 |
11850-11851 |
-LRB- |
denotes |
( |
T2998 |
11851-11855 |
NN |
denotes |
Fig. |
T2999 |
11856-11858 |
CD |
denotes |
6A |
T3000 |
11858-11860 |
, |
denotes |
, |
T2997 |
11860-11864 |
NN |
denotes |
lane |
T3001 |
11865-11866 |
CD |
denotes |
2 |
T3002 |
11866-11867 |
-RRB- |
denotes |
) |
T3003 |
11867-11868 |
. |
denotes |
. |
T3004 |
11868-11983 |
sentence |
denotes |
As expected, the antibody produced by the conserved sequence peptide detected all Acdp proteins (Fig. 6A, lane 1). |
T3005 |
11869-11871 |
IN |
denotes |
As |
T3006 |
11872-11880 |
VBN |
denotes |
expected |
T3008 |
11880-11882 |
, |
denotes |
, |
T3009 |
11882-11885 |
DT |
denotes |
the |
T3010 |
11886-11894 |
NN |
denotes |
antibody |
T3011 |
11895-11903 |
VBN |
denotes |
produced |
T3012 |
11904-11906 |
IN |
denotes |
by |
T3013 |
11907-11910 |
DT |
denotes |
the |
T3015 |
11911-11920 |
VBN |
denotes |
conserved |
T3016 |
11921-11929 |
NN |
denotes |
sequence |
T3014 |
11930-11937 |
NN |
denotes |
peptide |
T3007 |
11938-11946 |
VBD |
denotes |
detected |
T3017 |
11947-11950 |
DT |
denotes |
all |
T3019 |
11951-11955 |
NN |
denotes |
Acdp |
T3018 |
11956-11964 |
NN |
denotes |
proteins |
T3020 |
11965-11966 |
-LRB- |
denotes |
( |
T3022 |
11966-11970 |
NN |
denotes |
Fig. |
T3023 |
11971-11973 |
CD |
denotes |
6A |
T3024 |
11973-11975 |
, |
denotes |
, |
T3021 |
11975-11979 |
NN |
denotes |
lane |
T3025 |
11980-11981 |
CD |
denotes |
1 |
T3026 |
11981-11982 |
-RRB- |
denotes |
) |
T3027 |
11982-11983 |
. |
denotes |
. |
T3028 |
11983-12118 |
sentence |
denotes |
To further determine the specificity of the antibody against the Acdp1 C-terminus, we analyzed extracts of HEK293, 3T3 and PC12 cells. |
T3029 |
11984-11986 |
TO |
denotes |
To |
T3031 |
11987-11994 |
RB |
denotes |
further |
T3030 |
11995-12004 |
VB |
denotes |
determine |
T3033 |
12005-12008 |
DT |
denotes |
the |
T3034 |
12009-12020 |
NN |
denotes |
specificity |
T3035 |
12021-12023 |
IN |
denotes |
of |
T3036 |
12024-12027 |
DT |
denotes |
the |
T3037 |
12028-12036 |
NN |
denotes |
antibody |
T3038 |
12037-12044 |
IN |
denotes |
against |
T3039 |
12045-12048 |
DT |
denotes |
the |
T3041 |
12049-12054 |
NN |
denotes |
Acdp1 |
T3042 |
12055-12056 |
NN |
denotes |
C |
T3043 |
12056-12057 |
HYPH |
denotes |
- |
T3040 |
12057-12065 |
NN |
denotes |
terminus |
T3044 |
12065-12067 |
, |
denotes |
, |
T3045 |
12067-12069 |
PRP |
denotes |
we |
T3032 |
12070-12078 |
VBD |
denotes |
analyzed |
T3046 |
12079-12087 |
NNS |
denotes |
extracts |
T3047 |
12088-12090 |
IN |
denotes |
of |
T3048 |
12091-12097 |
NN |
denotes |
HEK293 |
T3050 |
12097-12099 |
, |
denotes |
, |
T3051 |
12099-12102 |
NN |
denotes |
3T3 |
T3052 |
12103-12106 |
CC |
denotes |
and |
T3053 |
12107-12111 |
NN |
denotes |
PC12 |
T3049 |
12112-12117 |
NNS |
denotes |
cells |
T3054 |
12117-12118 |
. |
denotes |
. |
T3055 |
12118-12152 |
sentence |
denotes |
The results are shown in Fig. 6B. |
T3056 |
12119-12122 |
DT |
denotes |
The |
T3057 |
12123-12130 |
NNS |
denotes |
results |
T3059 |
12131-12134 |
VBP |
denotes |
are |
T3058 |
12135-12140 |
VBN |
denotes |
shown |
T3060 |
12141-12143 |
IN |
denotes |
in |
T3061 |
12144-12148 |
NN |
denotes |
Fig. |
T3062 |
12149-12151 |
CD |
denotes |
6B |
T3063 |
12151-12152 |
. |
denotes |
. |
T3064 |
12152-12233 |
sentence |
denotes |
Apparently, this antibody detected a specific band of Acdp1 in all cell lysates. |
T3065 |
12153-12163 |
RB |
denotes |
Apparently |
T3067 |
12163-12165 |
, |
denotes |
, |
T3068 |
12165-12169 |
DT |
denotes |
this |
T3069 |
12170-12178 |
NN |
denotes |
antibody |
T3066 |
12179-12187 |
VBD |
denotes |
detected |
T3070 |
12188-12189 |
DT |
denotes |
a |
T3072 |
12190-12198 |
JJ |
denotes |
specific |
T3071 |
12199-12203 |
NN |
denotes |
band |
T3073 |
12204-12206 |
IN |
denotes |
of |
T3074 |
12207-12212 |
NN |
denotes |
Acdp1 |
T3075 |
12213-12215 |
IN |
denotes |
in |
T3076 |
12216-12219 |
DT |
denotes |
all |
T3078 |
12220-12224 |
NN |
denotes |
cell |
T3077 |
12225-12232 |
NNS |
denotes |
lysates |
T3079 |
12232-12233 |
. |
denotes |
. |
T3080 |
12233-12359 |
sentence |
denotes |
Of note, shown in Fig. 6B are signals of 10 μg extracts of HEK293 cell lysates, 100 μg extracts of 3T3 and PC12 cell lysates. |
T3081 |
12234-12236 |
IN |
denotes |
Of |
T3083 |
12237-12241 |
NN |
denotes |
note |
T3084 |
12241-12243 |
, |
denotes |
, |
T3085 |
12243-12248 |
VBN |
denotes |
shown |
T3086 |
12249-12251 |
IN |
denotes |
in |
T3087 |
12252-12256 |
NN |
denotes |
Fig. |
T3088 |
12257-12259 |
CD |
denotes |
6B |
T3082 |
12260-12263 |
VBP |
denotes |
are |
T3089 |
12264-12271 |
NNS |
denotes |
signals |
T3090 |
12272-12274 |
IN |
denotes |
of |
T3091 |
12275-12277 |
CD |
denotes |
10 |
T3092 |
12278-12280 |
NN |
denotes |
μg |
T3093 |
12281-12289 |
NNS |
denotes |
extracts |
T3094 |
12290-12292 |
IN |
denotes |
of |
T3095 |
12293-12299 |
NN |
denotes |
HEK293 |
T3097 |
12300-12304 |
NN |
denotes |
cell |
T3096 |
12305-12312 |
NNS |
denotes |
lysates |
T3098 |
12312-12314 |
, |
denotes |
, |
T3099 |
12314-12317 |
CD |
denotes |
100 |
T3100 |
12318-12320 |
NN |
denotes |
μg |
T3101 |
12321-12329 |
NNS |
denotes |
extracts |
T3102 |
12330-12332 |
IN |
denotes |
of |
T3103 |
12333-12336 |
NN |
denotes |
3T3 |
T3105 |
12337-12340 |
CC |
denotes |
and |
T3106 |
12341-12345 |
NN |
denotes |
PC12 |
T3107 |
12346-12350 |
NN |
denotes |
cell |
T3104 |
12351-12358 |
NNS |
denotes |
lysates |
T3108 |
12358-12359 |
. |
denotes |
. |
T3109 |
12359-12473 |
sentence |
denotes |
Thus, the expression levels of Acdp1 in these cell types vary a lot, with the highest expression in HEK293 cells. |
T3110 |
12360-12364 |
RB |
denotes |
Thus |
T3112 |
12364-12366 |
, |
denotes |
, |
T3113 |
12366-12369 |
DT |
denotes |
the |
T3115 |
12370-12380 |
NN |
denotes |
expression |
T3114 |
12381-12387 |
NNS |
denotes |
levels |
T3116 |
12388-12390 |
IN |
denotes |
of |
T3117 |
12391-12396 |
NN |
denotes |
Acdp1 |
T3118 |
12397-12399 |
IN |
denotes |
in |
T3119 |
12400-12405 |
DT |
denotes |
these |
T3121 |
12406-12410 |
NN |
denotes |
cell |
T3120 |
12411-12416 |
NNS |
denotes |
types |
T3111 |
12417-12421 |
VBP |
denotes |
vary |
T3122 |
12422-12423 |
DT |
denotes |
a |
T3123 |
12424-12427 |
NN |
denotes |
lot |
T3124 |
12427-12429 |
, |
denotes |
, |
T3125 |
12429-12433 |
IN |
denotes |
with |
T3126 |
12434-12437 |
DT |
denotes |
the |
T3128 |
12438-12445 |
JJS |
denotes |
highest |
T3127 |
12446-12456 |
NN |
denotes |
expression |
T3129 |
12457-12459 |
IN |
denotes |
in |
T3130 |
12460-12466 |
NN |
denotes |
HEK293 |
T3131 |
12467-12472 |
NNS |
denotes |
cells |
T3132 |
12472-12473 |
. |
denotes |
. |
T3133 |
12473-12633 |
sentence |
denotes |
Nevertheless, these immunoblot results support our analysis of brain tissue extracts that the antibody against Acdp1 C-terminus specifically recognizes Acdp-1. |
T3134 |
12474-12486 |
RB |
denotes |
Nevertheless |
T3136 |
12486-12488 |
, |
denotes |
, |
T3137 |
12488-12493 |
DT |
denotes |
these |
T3139 |
12494-12504 |
NN |
denotes |
immunoblot |
T3138 |
12505-12512 |
NNS |
denotes |
results |
T3135 |
12513-12520 |
VBP |
denotes |
support |
T3140 |
12521-12524 |
PRP$ |
denotes |
our |
T3141 |
12525-12533 |
NN |
denotes |
analysis |
T3142 |
12534-12536 |
IN |
denotes |
of |
T3143 |
12537-12542 |
NN |
denotes |
brain |
T3145 |
12543-12549 |
NN |
denotes |
tissue |
T3144 |
12550-12558 |
NNS |
denotes |
extracts |
T3146 |
12559-12563 |
IN |
denotes |
that |
T3148 |
12564-12567 |
DT |
denotes |
the |
T3149 |
12568-12576 |
NN |
denotes |
antibody |
T3150 |
12577-12584 |
IN |
denotes |
against |
T3151 |
12585-12590 |
NN |
denotes |
Acdp1 |
T3153 |
12591-12592 |
NN |
denotes |
C |
T3154 |
12592-12593 |
HYPH |
denotes |
- |
T3152 |
12593-12601 |
NN |
denotes |
terminus |
T3155 |
12602-12614 |
RB |
denotes |
specifically |
T3147 |
12615-12625 |
VBZ |
denotes |
recognizes |
T3156 |
12626-12630 |
NN |
denotes |
Acdp |
T3157 |
12630-12631 |
HYPH |
denotes |
- |
T3158 |
12631-12632 |
CD |
denotes |
1 |
T3159 |
12632-12633 |
. |
denotes |
. |
T3160 |
12633-12752 |
sentence |
denotes |
The specificity of the Acdp1 C-terminus antibody suggests the possibility of using it to localize Acdp-1 within cells. |
T3161 |
12634-12637 |
DT |
denotes |
The |
T3162 |
12638-12649 |
NN |
denotes |
specificity |
T3164 |
12650-12652 |
IN |
denotes |
of |
T3165 |
12653-12656 |
DT |
denotes |
the |
T3167 |
12657-12662 |
NN |
denotes |
Acdp1 |
T3168 |
12663-12664 |
NN |
denotes |
C |
T3170 |
12664-12665 |
HYPH |
denotes |
- |
T3169 |
12665-12673 |
NN |
denotes |
terminus |
T3166 |
12674-12682 |
NN |
denotes |
antibody |
T3163 |
12683-12691 |
VBZ |
denotes |
suggests |
T3171 |
12692-12695 |
DT |
denotes |
the |
T3172 |
12696-12707 |
NN |
denotes |
possibility |
T3173 |
12708-12710 |
IN |
denotes |
of |
T3174 |
12711-12716 |
VBG |
denotes |
using |
T3175 |
12717-12719 |
PRP |
denotes |
it |
T3176 |
12720-12722 |
TO |
denotes |
to |
T3177 |
12723-12731 |
VB |
denotes |
localize |
T3178 |
12732-12736 |
NN |
denotes |
Acdp |
T3179 |
12736-12737 |
HYPH |
denotes |
- |
T3180 |
12737-12738 |
CD |
denotes |
1 |
T3181 |
12739-12745 |
IN |
denotes |
within |
T3182 |
12746-12751 |
NNS |
denotes |
cells |
T3183 |
12751-12752 |
. |
denotes |
. |
T3184 |
12752-12925 |
sentence |
denotes |
Since Northern blot revealed almost exclusive expression of Acdp1 in the brain, we examined its subcellular localization in hippocampus neurons isolated from mouse embryos. |
T3185 |
12753-12758 |
IN |
denotes |
Since |
T3187 |
12759-12767 |
NNP |
denotes |
Northern |
T3188 |
12768-12772 |
NN |
denotes |
blot |
T3186 |
12773-12781 |
VBD |
denotes |
revealed |
T3190 |
12782-12788 |
RB |
denotes |
almost |
T3191 |
12789-12798 |
JJ |
denotes |
exclusive |
T3192 |
12799-12809 |
NN |
denotes |
expression |
T3193 |
12810-12812 |
IN |
denotes |
of |
T3194 |
12813-12818 |
NN |
denotes |
Acdp1 |
T3195 |
12819-12821 |
IN |
denotes |
in |
T3196 |
12822-12825 |
DT |
denotes |
the |
T3197 |
12826-12831 |
NN |
denotes |
brain |
T3198 |
12831-12833 |
, |
denotes |
, |
T3199 |
12833-12835 |
PRP |
denotes |
we |
T3189 |
12836-12844 |
VBD |
denotes |
examined |
T3200 |
12845-12848 |
PRP$ |
denotes |
its |
T3202 |
12849-12860 |
JJ |
denotes |
subcellular |
T3201 |
12861-12873 |
NN |
denotes |
localization |
T3203 |
12874-12876 |
IN |
denotes |
in |
T3204 |
12877-12888 |
NN |
denotes |
hippocampus |
T3205 |
12889-12896 |
NNS |
denotes |
neurons |
T3206 |
12897-12905 |
VBN |
denotes |
isolated |
T3207 |
12906-12910 |
IN |
denotes |
from |
T3208 |
12911-12916 |
NN |
denotes |
mouse |
T3209 |
12917-12924 |
NNS |
denotes |
embryos |
T3210 |
12924-12925 |
. |
denotes |
. |
T3211 |
12925-13045 |
sentence |
denotes |
The neurons were cultured on glass coverslips coated with a confluent monolayer of mouse cortical astrocytes in dishes. |
T3212 |
12926-12929 |
DT |
denotes |
The |
T3213 |
12930-12937 |
NNS |
denotes |
neurons |
T3215 |
12938-12942 |
VBD |
denotes |
were |
T3214 |
12943-12951 |
VBN |
denotes |
cultured |
T3216 |
12952-12954 |
IN |
denotes |
on |
T3217 |
12955-12960 |
NN |
denotes |
glass |
T3218 |
12961-12971 |
NNS |
denotes |
coverslips |
T3219 |
12972-12978 |
VBN |
denotes |
coated |
T3220 |
12979-12983 |
IN |
denotes |
with |
T3221 |
12984-12985 |
DT |
denotes |
a |
T3223 |
12986-12995 |
JJ |
denotes |
confluent |
T3222 |
12996-13005 |
NN |
denotes |
monolayer |
T3224 |
13006-13008 |
IN |
denotes |
of |
T3225 |
13009-13014 |
NN |
denotes |
mouse |
T3227 |
13015-13023 |
JJ |
denotes |
cortical |
T3226 |
13024-13034 |
NNS |
denotes |
astrocytes |
T3228 |
13035-13037 |
IN |
denotes |
in |
T3229 |
13038-13044 |
NNS |
denotes |
dishes |
T3230 |
13044-13045 |
. |
denotes |
. |
T3231 |
13045-13110 |
sentence |
denotes |
Immunostaining was using the Acdp1 C-terminus specific antibody. |
T3232 |
13046-13060 |
NN |
denotes |
Immunostaining |
T3234 |
13061-13064 |
VBD |
denotes |
was |
T3233 |
13065-13070 |
VBG |
denotes |
using |
T3235 |
13071-13074 |
DT |
denotes |
the |
T3237 |
13075-13080 |
NN |
denotes |
Acdp1 |
T3238 |
13081-13082 |
NN |
denotes |
C |
T3240 |
13082-13083 |
HYPH |
denotes |
- |
T3239 |
13083-13091 |
NN |
denotes |
terminus |
T3241 |
13092-13100 |
JJ |
denotes |
specific |
T3236 |
13101-13109 |
NN |
denotes |
antibody |
T3242 |
13109-13110 |
. |
denotes |
. |
T3243 |
13110-13198 |
sentence |
denotes |
Confocal imaging revealed that Acdp1 is predominantly localized on the plasma membrane. |
T3244 |
13111-13119 |
JJ |
denotes |
Confocal |
T3245 |
13120-13127 |
NN |
denotes |
imaging |
T3246 |
13128-13136 |
VBD |
denotes |
revealed |
T3247 |
13137-13141 |
IN |
denotes |
that |
T3249 |
13142-13147 |
NN |
denotes |
Acdp1 |
T3250 |
13148-13150 |
VBZ |
denotes |
is |
T3251 |
13151-13164 |
RB |
denotes |
predominantly |
T3248 |
13165-13174 |
VBN |
denotes |
localized |
T3252 |
13175-13177 |
IN |
denotes |
on |
T3253 |
13178-13181 |
DT |
denotes |
the |
T3255 |
13182-13188 |
NN |
denotes |
plasma |
T3254 |
13189-13197 |
NN |
denotes |
membrane |
T3256 |
13197-13198 |
. |
denotes |
. |
T3257 |
13198-13425 |
sentence |
denotes |
A series of sections of a cell at the thickness of 0.5 micrometer clearly showed membrane location of Acdp1-immunoreactivity (Fig. 7), which is consistent with the observation of transmembrane domains within the Acdp proteins. |
T3258 |
13199-13200 |
DT |
denotes |
A |
T3259 |
13201-13207 |
NN |
denotes |
series |
T3261 |
13208-13210 |
IN |
denotes |
of |
T3262 |
13211-13219 |
NNS |
denotes |
sections |
T3263 |
13220-13222 |
IN |
denotes |
of |
T3264 |
13223-13224 |
DT |
denotes |
a |
T3265 |
13225-13229 |
NN |
denotes |
cell |
T3266 |
13230-13232 |
IN |
denotes |
at |
T3267 |
13233-13236 |
DT |
denotes |
the |
T3268 |
13237-13246 |
NN |
denotes |
thickness |
T3269 |
13247-13249 |
IN |
denotes |
of |
T3270 |
13250-13253 |
CD |
denotes |
0.5 |
T3271 |
13254-13264 |
NN |
denotes |
micrometer |
T3272 |
13265-13272 |
RB |
denotes |
clearly |
T3260 |
13273-13279 |
VBD |
denotes |
showed |
T3273 |
13280-13288 |
NN |
denotes |
membrane |
T3274 |
13289-13297 |
NN |
denotes |
location |
T3275 |
13298-13300 |
IN |
denotes |
of |
T3276 |
13301-13306 |
NN |
denotes |
Acdp1 |
T3278 |
13306-13307 |
HYPH |
denotes |
- |
T3277 |
13307-13323 |
NN |
denotes |
immunoreactivity |
T3279 |
13324-13325 |
-LRB- |
denotes |
( |
T3280 |
13325-13329 |
NN |
denotes |
Fig. |
T3281 |
13330-13331 |
CD |
denotes |
7 |
T3282 |
13331-13332 |
-RRB- |
denotes |
) |
T3283 |
13332-13334 |
, |
denotes |
, |
T3284 |
13334-13339 |
WDT |
denotes |
which |
T3285 |
13340-13342 |
VBZ |
denotes |
is |
T3286 |
13343-13353 |
JJ |
denotes |
consistent |
T3287 |
13354-13358 |
IN |
denotes |
with |
T3288 |
13359-13362 |
DT |
denotes |
the |
T3289 |
13363-13374 |
NN |
denotes |
observation |
T3290 |
13375-13377 |
IN |
denotes |
of |
T3291 |
13378-13391 |
NN |
denotes |
transmembrane |
T3292 |
13392-13399 |
NNS |
denotes |
domains |
T3293 |
13400-13406 |
IN |
denotes |
within |
T3294 |
13407-13410 |
DT |
denotes |
the |
T3296 |
13411-13415 |
NN |
denotes |
Acdp |
T3295 |
13416-13424 |
NN |
denotes |
proteins |
T3297 |
13424-13425 |
. |
denotes |
. |
T6368 |
13436-13440 |
NN |
denotes |
Fig. |
T6370 |
13441-13443 |
CD |
denotes |
6A |
T6371 |
13443-13445 |
: |
denotes |
: |
T6372 |
13445-13455 |
NN |
denotes |
Immunoblot |
T6369 |
13456-13464 |
NN |
denotes |
analysis |
T6373 |
13465-13467 |
IN |
denotes |
of |
T6374 |
13468-13472 |
NN |
denotes |
Acdp |
T6375 |
13473-13481 |
NN |
denotes |
proteins |
T6376 |
13482-13484 |
IN |
denotes |
in |
T6377 |
13485-13490 |
NN |
denotes |
brain |
T6378 |
13491-13497 |
NN |
denotes |
tissue |
T6379 |
13498-13506 |
NNS |
denotes |
extracts |
T6380 |
13506-13507 |
. |
denotes |
. |
T6381 |
13507-13597 |
sentence |
denotes |
Immunoblotting were carried out using a Western blotting detection system (ECL) (PIERCE). |
T6382 |
13508-13522 |
NN |
denotes |
Immunoblotting |
T6384 |
13523-13527 |
VBD |
denotes |
were |
T6383 |
13528-13535 |
VBN |
denotes |
carried |
T6385 |
13536-13539 |
RP |
denotes |
out |
T6386 |
13540-13545 |
VBG |
denotes |
using |
T6387 |
13546-13547 |
DT |
denotes |
a |
T6389 |
13548-13555 |
NNP |
denotes |
Western |
T6390 |
13556-13564 |
NN |
denotes |
blotting |
T6391 |
13565-13574 |
NN |
denotes |
detection |
T6388 |
13575-13581 |
NN |
denotes |
system |
T6392 |
13582-13583 |
-LRB- |
denotes |
( |
T6393 |
13583-13586 |
NN |
denotes |
ECL |
T6394 |
13586-13587 |
-RRB- |
denotes |
) |
T6395 |
13588-13589 |
-LRB- |
denotes |
( |
T6396 |
13589-13595 |
NN |
denotes |
PIERCE |
T6397 |
13595-13596 |
-RRB- |
denotes |
) |
T6398 |
13596-13597 |
. |
denotes |
. |
T6399 |
13597-13658 |
sentence |
denotes |
Lane 1, probed with antibody generated by conserved peptide. |
T6400 |
13598-13602 |
NN |
denotes |
Lane |
T6402 |
13603-13604 |
CD |
denotes |
1 |
T6403 |
13604-13606 |
, |
denotes |
, |
T6401 |
13606-13612 |
VBN |
denotes |
probed |
T6404 |
13613-13617 |
IN |
denotes |
with |
T6405 |
13618-13626 |
NN |
denotes |
antibody |
T6406 |
13627-13636 |
VBN |
denotes |
generated |
T6407 |
13637-13639 |
IN |
denotes |
by |
T6408 |
13640-13649 |
JJ |
denotes |
conserved |
T6409 |
13650-13657 |
NN |
denotes |
peptide |
T6410 |
13657-13658 |
. |
denotes |
. |
T6411 |
13658-13770 |
sentence |
denotes |
From top to bottom, each band corresponding to Acdp1 (115 kD), Acdp2 (100 kD), Acdp4 (90 kD) and Acdp3 (80 kD). |
T6412 |
13659-13663 |
IN |
denotes |
From |
T6414 |
13664-13667 |
NN |
denotes |
top |
T6415 |
13668-13670 |
IN |
denotes |
to |
T6416 |
13671-13677 |
NN |
denotes |
bottom |
T6417 |
13677-13679 |
, |
denotes |
, |
T6418 |
13679-13683 |
DT |
denotes |
each |
T6413 |
13684-13688 |
NN |
denotes |
band |
T6419 |
13689-13702 |
VBG |
denotes |
corresponding |
T6420 |
13703-13705 |
IN |
denotes |
to |
T6421 |
13706-13711 |
NN |
denotes |
Acdp1 |
T6422 |
13712-13713 |
-LRB- |
denotes |
( |
T6424 |
13713-13716 |
CD |
denotes |
115 |
T6423 |
13717-13719 |
NN |
denotes |
kD |
T6425 |
13719-13720 |
-RRB- |
denotes |
) |
T6426 |
13720-13722 |
, |
denotes |
, |
T6427 |
13722-13727 |
NN |
denotes |
Acdp2 |
T6428 |
13728-13729 |
-LRB- |
denotes |
( |
T6430 |
13729-13732 |
CD |
denotes |
100 |
T6429 |
13733-13735 |
NN |
denotes |
kD |
T6431 |
13735-13736 |
-RRB- |
denotes |
) |
T6432 |
13736-13738 |
, |
denotes |
, |
T6433 |
13738-13743 |
NN |
denotes |
Acdp4 |
T6434 |
13744-13745 |
-LRB- |
denotes |
( |
T6436 |
13745-13747 |
CD |
denotes |
90 |
T6435 |
13748-13750 |
NN |
denotes |
kD |
T6437 |
13750-13751 |
-RRB- |
denotes |
) |
T6438 |
13752-13755 |
CC |
denotes |
and |
T6439 |
13756-13761 |
NN |
denotes |
Acdp3 |
T6440 |
13762-13763 |
-LRB- |
denotes |
( |
T6442 |
13763-13765 |
CD |
denotes |
80 |
T6441 |
13766-13768 |
NN |
denotes |
kD |
T6443 |
13768-13769 |
-RRB- |
denotes |
) |
T6444 |
13769-13770 |
. |
denotes |
. |
T6445 |
13770-13880 |
sentence |
denotes |
Lane 2 and 3, probed with the Acdp1 antibodies generated by N-terminal and C-terminal peptides, respectively. |
T6446 |
13771-13775 |
NN |
denotes |
Lane |
T6447 |
13776-13777 |
CD |
denotes |
2 |
T6449 |
13778-13781 |
CC |
denotes |
and |
T6450 |
13782-13783 |
CD |
denotes |
3 |
T6451 |
13783-13785 |
, |
denotes |
, |
T6448 |
13785-13791 |
VBN |
denotes |
probed |
T6452 |
13792-13796 |
IN |
denotes |
with |
T6453 |
13797-13800 |
DT |
denotes |
the |
T6455 |
13801-13806 |
NN |
denotes |
Acdp1 |
T6454 |
13807-13817 |
NNS |
denotes |
antibodies |
T6456 |
13818-13827 |
VBN |
denotes |
generated |
T6457 |
13828-13830 |
IN |
denotes |
by |
T6458 |
13831-13832 |
NN |
denotes |
N |
T6460 |
13832-13833 |
HYPH |
denotes |
- |
T6459 |
13833-13841 |
JJ |
denotes |
terminal |
T6462 |
13842-13845 |
CC |
denotes |
and |
T6463 |
13846-13847 |
NN |
denotes |
C |
T6465 |
13847-13848 |
HYPH |
denotes |
- |
T6464 |
13848-13856 |
JJ |
denotes |
terminal |
T6461 |
13857-13865 |
NNS |
denotes |
peptides |
T6466 |
13865-13867 |
, |
denotes |
, |
T6467 |
13867-13879 |
RB |
denotes |
respectively |
T6468 |
13879-13880 |
. |
denotes |
. |
T6469 |
13880-13949 |
sentence |
denotes |
Fig. 6B: Immunoblot analysis of Acdp1 in HEK293, 3T3 and PC12 cells. |
T6470 |
13881-13885 |
NN |
denotes |
Fig. |
T6472 |
13886-13888 |
CD |
denotes |
6B |
T6473 |
13888-13890 |
: |
denotes |
: |
T6474 |
13890-13900 |
NN |
denotes |
Immunoblot |
T6471 |
13901-13909 |
NN |
denotes |
analysis |
T6475 |
13910-13912 |
IN |
denotes |
of |
T6476 |
13913-13918 |
NN |
denotes |
Acdp1 |
T6477 |
13919-13921 |
IN |
denotes |
in |
T6478 |
13922-13928 |
NN |
denotes |
HEK293 |
T6480 |
13928-13930 |
, |
denotes |
, |
T6481 |
13930-13933 |
NN |
denotes |
3T3 |
T6482 |
13934-13937 |
CC |
denotes |
and |
T6483 |
13938-13942 |
NN |
denotes |
PC12 |
T6479 |
13943-13948 |
NNS |
denotes |
cells |
T6484 |
13948-13949 |
. |
denotes |
. |
T6485 |
13949-14023 |
sentence |
denotes |
The blots were probed with the antibody against the C-terminus of Acdp-1. |
T6486 |
13950-13953 |
DT |
denotes |
The |
T6487 |
13954-13959 |
NNS |
denotes |
blots |
T6489 |
13960-13964 |
VBD |
denotes |
were |
T6488 |
13965-13971 |
VBN |
denotes |
probed |
T6490 |
13972-13976 |
IN |
denotes |
with |
T6491 |
13977-13980 |
DT |
denotes |
the |
T6492 |
13981-13989 |
NN |
denotes |
antibody |
T6493 |
13990-13997 |
IN |
denotes |
against |
T6494 |
13998-14001 |
DT |
denotes |
the |
T6496 |
14002-14003 |
NN |
denotes |
C |
T6497 |
14003-14004 |
HYPH |
denotes |
- |
T6495 |
14004-14012 |
NN |
denotes |
terminus |
T6498 |
14013-14015 |
IN |
denotes |
of |
T6499 |
14016-14020 |
NN |
denotes |
Acdp |
T6500 |
14020-14021 |
HYPH |
denotes |
- |
T6501 |
14021-14022 |
CD |
denotes |
1 |
T6502 |
14022-14023 |
. |
denotes |
. |
T6503 |
14023-14061 |
sentence |
denotes |
Lane 1, 10 μg of HEK293 cell lysates. |
T6504 |
14024-14028 |
NN |
denotes |
Lane |
T6506 |
14029-14030 |
CD |
denotes |
1 |
T6507 |
14030-14032 |
, |
denotes |
, |
T6508 |
14032-14034 |
CD |
denotes |
10 |
T6505 |
14035-14037 |
NNS |
denotes |
μg |
T6509 |
14038-14040 |
IN |
denotes |
of |
T6510 |
14041-14047 |
NN |
denotes |
HEK293 |
T6512 |
14048-14052 |
NN |
denotes |
cell |
T6511 |
14053-14060 |
NNS |
denotes |
lysates |
T6513 |
14060-14061 |
. |
denotes |
. |
T6514 |
14061-14112 |
sentence |
denotes |
Lane 2 and 3, 100 μg of 3T3 and PC12 cell lysates. |
T6515 |
14062-14066 |
NN |
denotes |
Lane |
T6516 |
14067-14068 |
CD |
denotes |
2 |
T6518 |
14069-14072 |
CC |
denotes |
and |
T6519 |
14073-14074 |
CD |
denotes |
3 |
T6520 |
14074-14076 |
, |
denotes |
, |
T6521 |
14076-14079 |
CD |
denotes |
100 |
T6517 |
14080-14082 |
NNS |
denotes |
μg |
T6522 |
14083-14085 |
IN |
denotes |
of |
T6523 |
14086-14089 |
NN |
denotes |
3T3 |
T6525 |
14090-14093 |
CC |
denotes |
and |
T6526 |
14094-14098 |
NN |
denotes |
PC12 |
T6527 |
14099-14103 |
NN |
denotes |
cell |
T6524 |
14104-14111 |
NNS |
denotes |
lysates |
T6528 |
14111-14112 |
. |
denotes |
. |
T6553 |
14123-14134 |
JJ |
denotes |
Subcellular |
T6554 |
14135-14147 |
NN |
denotes |
localization |
T6555 |
14148-14150 |
IN |
denotes |
of |
T6556 |
14151-14156 |
NN |
denotes |
Acdp1 |
T6557 |
14157-14159 |
IN |
denotes |
in |
T6558 |
14160-14171 |
NN |
denotes |
hippocampus |
T6559 |
14172-14179 |
NNS |
denotes |
neurons |
T6560 |
14179-14180 |
. |
denotes |
. |
T6561 |
14180-14268 |
sentence |
denotes |
A series of confocal images from a cultured neuron stained with an anti-Acdp1 antibody. |
T6562 |
14181-14182 |
DT |
denotes |
A |
T6563 |
14183-14189 |
NN |
denotes |
series |
T6564 |
14190-14192 |
IN |
denotes |
of |
T6565 |
14193-14201 |
JJ |
denotes |
confocal |
T6566 |
14202-14208 |
NNS |
denotes |
images |
T6567 |
14209-14213 |
IN |
denotes |
from |
T6568 |
14214-14215 |
DT |
denotes |
a |
T6570 |
14216-14224 |
VBN |
denotes |
cultured |
T6569 |
14225-14231 |
NN |
denotes |
neuron |
T6571 |
14232-14239 |
VBN |
denotes |
stained |
T6572 |
14240-14244 |
IN |
denotes |
with |
T6573 |
14245-14247 |
DT |
denotes |
an |
T6575 |
14248-14258 |
JJ |
denotes |
anti-Acdp1 |
T6574 |
14259-14267 |
NN |
denotes |
antibody |
T6576 |
14267-14268 |
. |
denotes |
. |
T6577 |
14268-14379 |
sentence |
denotes |
The step of each imaging section is 0.5 μm, from the surface of the neuron (0 μm) to the middle plan (4.5 μm). |
T6578 |
14269-14272 |
DT |
denotes |
The |
T6579 |
14273-14277 |
NN |
denotes |
step |
T6581 |
14278-14280 |
IN |
denotes |
of |
T6582 |
14281-14285 |
DT |
denotes |
each |
T6584 |
14286-14293 |
NN |
denotes |
imaging |
T6583 |
14294-14301 |
NN |
denotes |
section |
T6580 |
14302-14304 |
VBZ |
denotes |
is |
T6585 |
14305-14308 |
CD |
denotes |
0.5 |
T6586 |
14309-14311 |
NNS |
denotes |
μm |
T6587 |
14311-14313 |
, |
denotes |
, |
T6588 |
14313-14317 |
IN |
denotes |
from |
T6589 |
14318-14321 |
DT |
denotes |
the |
T6590 |
14322-14329 |
NN |
denotes |
surface |
T6591 |
14330-14332 |
IN |
denotes |
of |
T6592 |
14333-14336 |
DT |
denotes |
the |
T6593 |
14337-14343 |
NN |
denotes |
neuron |
T6594 |
14344-14345 |
-LRB- |
denotes |
( |
T6596 |
14345-14346 |
CD |
denotes |
0 |
T6595 |
14347-14349 |
NNS |
denotes |
μm |
T6597 |
14349-14350 |
-RRB- |
denotes |
) |
T6598 |
14351-14353 |
IN |
denotes |
to |
T6599 |
14354-14357 |
DT |
denotes |
the |
T6601 |
14358-14364 |
JJ |
denotes |
middle |
T6600 |
14365-14369 |
NN |
denotes |
plan |
T6602 |
14370-14371 |
-LRB- |
denotes |
( |
T6604 |
14371-14374 |
CD |
denotes |
4.5 |
T6603 |
14375-14377 |
NNS |
denotes |
μm |
T6605 |
14377-14378 |
-RRB- |
denotes |
) |
T6606 |
14378-14379 |
. |
denotes |
. |
T3529 |
14392-14400 |
IN |
denotes |
Although |
T3531 |
14401-14404 |
DT |
denotes |
the |
T3533 |
14405-14410 |
JJ |
denotes |
exact |
T3532 |
14411-14420 |
NNS |
denotes |
functions |
T3534 |
14421-14423 |
IN |
denotes |
of |
T3535 |
14424-14427 |
DT |
denotes |
the |
T3537 |
14428-14432 |
NN |
denotes |
ACDP |
T3538 |
14433-14437 |
NN |
denotes |
gene |
T3536 |
14438-14444 |
NN |
denotes |
family |
T3539 |
14445-14448 |
VBP |
denotes |
are |
T3540 |
14449-14452 |
RB |
denotes |
not |
T3541 |
14453-14456 |
RB |
denotes |
yet |
T3530 |
14457-14467 |
VBN |
denotes |
elucidated |
T3543 |
14467-14469 |
, |
denotes |
, |
T3544 |
14469-14476 |
JJ |
denotes |
several |
T3545 |
14477-14482 |
NNS |
denotes |
lines |
T3546 |
14483-14485 |
IN |
denotes |
of |
T3547 |
14486-14494 |
NN |
denotes |
evidence |
T3542 |
14495-14502 |
VBP |
denotes |
suggest |
T3548 |
14503-14507 |
IN |
denotes |
that |
T3550 |
14508-14512 |
NN |
denotes |
ACDP |
T3551 |
14513-14518 |
NNS |
denotes |
genes |
T3552 |
14519-14522 |
MD |
denotes |
may |
T3549 |
14523-14527 |
VB |
denotes |
play |
T3553 |
14528-14530 |
DT |
denotes |
an |
T3555 |
14531-14540 |
JJ |
denotes |
important |
T3554 |
14541-14545 |
NN |
denotes |
role |
T3556 |
14546-14548 |
IN |
denotes |
in |
T3557 |
14549-14559 |
JJ |
denotes |
biological |
T3558 |
14560-14569 |
NNS |
denotes |
processes |
T3559 |
14569-14570 |
. |
denotes |
. |
T3560 |
14570-14818 |
sentence |
denotes |
First, these genes are evolutionarily conserved in many phylogenetically divergent species; Second, multiple genes are present in a species; Third, these genes are ubiquitously expressed throughout development and adult tissues (unpublished data). |
T3561 |
14571-14576 |
RB |
denotes |
First |
T3563 |
14576-14578 |
, |
denotes |
, |
T3564 |
14578-14583 |
DT |
denotes |
these |
T3565 |
14584-14589 |
NNS |
denotes |
genes |
T3566 |
14590-14593 |
VBP |
denotes |
are |
T3567 |
14594-14608 |
RB |
denotes |
evolutionarily |
T3562 |
14609-14618 |
VBN |
denotes |
conserved |
T3569 |
14619-14621 |
IN |
denotes |
in |
T3570 |
14622-14626 |
JJ |
denotes |
many |
T3572 |
14627-14643 |
RB |
denotes |
phylogenetically |
T3573 |
14644-14653 |
JJ |
denotes |
divergent |
T3571 |
14654-14661 |
NNS |
denotes |
species |
T3574 |
14661-14662 |
: |
denotes |
; |
T3575 |
14663-14669 |
RB |
denotes |
Second |
T3577 |
14669-14671 |
, |
denotes |
, |
T3578 |
14671-14679 |
JJ |
denotes |
multiple |
T3579 |
14680-14685 |
NNS |
denotes |
genes |
T3576 |
14686-14689 |
VBP |
denotes |
are |
T3580 |
14690-14697 |
JJ |
denotes |
present |
T3581 |
14698-14700 |
IN |
denotes |
in |
T3582 |
14701-14702 |
DT |
denotes |
a |
T3583 |
14703-14710 |
NN |
denotes |
species |
T3584 |
14710-14711 |
: |
denotes |
; |
T3585 |
14712-14717 |
RB |
denotes |
Third |
T3586 |
14717-14719 |
, |
denotes |
, |
T3587 |
14719-14724 |
DT |
denotes |
these |
T3588 |
14725-14730 |
NNS |
denotes |
genes |
T3589 |
14731-14734 |
VBP |
denotes |
are |
T3590 |
14735-14747 |
RB |
denotes |
ubiquitously |
T3568 |
14748-14757 |
VBN |
denotes |
expressed |
T3591 |
14758-14768 |
IN |
denotes |
throughout |
T3592 |
14769-14780 |
NN |
denotes |
development |
T3594 |
14781-14784 |
CC |
denotes |
and |
T3595 |
14785-14790 |
JJ |
denotes |
adult |
T3593 |
14791-14798 |
NNS |
denotes |
tissues |
T3596 |
14799-14800 |
-LRB- |
denotes |
( |
T3598 |
14800-14811 |
JJ |
denotes |
unpublished |
T3597 |
14812-14816 |
NNS |
denotes |
data |
T3599 |
14816-14817 |
-RRB- |
denotes |
) |
T3600 |
14817-14818 |
. |
denotes |
. |
T3601 |
14818-14974 |
sentence |
denotes |
The cloning and characterization of the mouse Acdp gene family are a very important step towards the elucidation of the functions of this multigene family. |
T3602 |
14819-14822 |
DT |
denotes |
The |
T3603 |
14823-14830 |
NN |
denotes |
cloning |
T3605 |
14831-14834 |
CC |
denotes |
and |
T3606 |
14835-14851 |
NN |
denotes |
characterization |
T3607 |
14852-14854 |
IN |
denotes |
of |
T3608 |
14855-14858 |
DT |
denotes |
the |
T3610 |
14859-14864 |
NN |
denotes |
mouse |
T3611 |
14865-14869 |
NN |
denotes |
Acdp |
T3612 |
14870-14874 |
NN |
denotes |
gene |
T3609 |
14875-14881 |
NN |
denotes |
family |
T3604 |
14882-14885 |
VBP |
denotes |
are |
T3613 |
14886-14887 |
DT |
denotes |
a |
T3615 |
14888-14892 |
RB |
denotes |
very |
T3616 |
14893-14902 |
JJ |
denotes |
important |
T3614 |
14903-14907 |
NN |
denotes |
step |
T3617 |
14908-14915 |
IN |
denotes |
towards |
T3618 |
14916-14919 |
DT |
denotes |
the |
T3619 |
14920-14931 |
NN |
denotes |
elucidation |
T3620 |
14932-14934 |
IN |
denotes |
of |
T3621 |
14935-14938 |
DT |
denotes |
the |
T3622 |
14939-14948 |
NNS |
denotes |
functions |
T3623 |
14949-14951 |
IN |
denotes |
of |
T3624 |
14952-14956 |
DT |
denotes |
this |
T3626 |
14957-14966 |
JJ |
denotes |
multigene |
T3625 |
14967-14973 |
NN |
denotes |
family |
T3627 |
14973-14974 |
. |
denotes |
. |
T3628 |
14974-15116 |
sentence |
denotes |
Sequence homology analyses revealed that Acdp proteins shared very strong AA homologies to the bacteria CorC protein and yeast Amip3 protein. |
T3629 |
14975-14983 |
NN |
denotes |
Sequence |
T3631 |
14984-14992 |
NN |
denotes |
homology |
T3630 |
14993-15001 |
NNS |
denotes |
analyses |
T3632 |
15002-15010 |
VBD |
denotes |
revealed |
T3633 |
15011-15015 |
IN |
denotes |
that |
T3635 |
15016-15020 |
NN |
denotes |
Acdp |
T3636 |
15021-15029 |
NN |
denotes |
proteins |
T3634 |
15030-15036 |
VBD |
denotes |
shared |
T3637 |
15037-15041 |
RB |
denotes |
very |
T3638 |
15042-15048 |
JJ |
denotes |
strong |
T3640 |
15049-15051 |
NN |
denotes |
AA |
T3639 |
15052-15062 |
NNS |
denotes |
homologies |
T3641 |
15063-15065 |
IN |
denotes |
to |
T3642 |
15066-15069 |
DT |
denotes |
the |
T3644 |
15070-15078 |
NNS |
denotes |
bacteria |
T3645 |
15079-15083 |
NN |
denotes |
CorC |
T3643 |
15084-15091 |
NN |
denotes |
protein |
T3646 |
15092-15095 |
CC |
denotes |
and |
T3647 |
15096-15101 |
NN |
denotes |
yeast |
T3649 |
15102-15107 |
NN |
denotes |
Amip3 |
T3648 |
15108-15115 |
NN |
denotes |
protein |
T3650 |
15115-15116 |
. |
denotes |
. |
T3651 |
15116-15220 |
sentence |
denotes |
CorA, B, C and D belong to a protein family involved in both influx and efflux of magnesium and cobalt. |
T3652 |
15117-15121 |
NN |
denotes |
CorA |
T3654 |
15121-15123 |
, |
denotes |
, |
T3655 |
15123-15124 |
NN |
denotes |
B |
T3656 |
15124-15126 |
, |
denotes |
, |
T3657 |
15126-15127 |
NN |
denotes |
C |
T3658 |
15128-15131 |
CC |
denotes |
and |
T3659 |
15132-15133 |
NN |
denotes |
D |
T3653 |
15134-15140 |
VBP |
denotes |
belong |
T3660 |
15141-15143 |
IN |
denotes |
to |
T3661 |
15144-15145 |
DT |
denotes |
a |
T3663 |
15146-15153 |
NN |
denotes |
protein |
T3662 |
15154-15160 |
NN |
denotes |
family |
T3664 |
15161-15169 |
VBN |
denotes |
involved |
T3665 |
15170-15172 |
IN |
denotes |
in |
T3666 |
15173-15177 |
CC |
denotes |
both |
T3667 |
15178-15184 |
NN |
denotes |
influx |
T3668 |
15185-15188 |
CC |
denotes |
and |
T3669 |
15189-15195 |
NN |
denotes |
efflux |
T3670 |
15196-15198 |
IN |
denotes |
of |
T3671 |
15199-15208 |
NN |
denotes |
magnesium |
T3672 |
15209-15212 |
CC |
denotes |
and |
T3673 |
15213-15219 |
NN |
denotes |
cobalt |
T3674 |
15219-15220 |
. |
denotes |
. |
T3675 |
15220-15298 |
sentence |
denotes |
It has been shown that CorA mutants confer resistance to cobalt toxicity [9]. |
T3676 |
15221-15223 |
PRP |
denotes |
It |
T3678 |
15224-15227 |
VBZ |
denotes |
has |
T3679 |
15228-15232 |
VBN |
denotes |
been |
T3677 |
15233-15238 |
VBN |
denotes |
shown |
T3680 |
15239-15243 |
IN |
denotes |
that |
T3682 |
15244-15248 |
NN |
denotes |
CorA |
T3683 |
15249-15256 |
NNS |
denotes |
mutants |
T3681 |
15257-15263 |
VBP |
denotes |
confer |
T3684 |
15264-15274 |
NN |
denotes |
resistance |
T3685 |
15275-15277 |
IN |
denotes |
to |
T3686 |
15278-15284 |
NN |
denotes |
cobalt |
T3687 |
15285-15293 |
NN |
denotes |
toxicity |
T3688 |
15294-15295 |
-LRB- |
denotes |
[ |
T3689 |
15295-15296 |
CD |
denotes |
9 |
T3690 |
15296-15297 |
-RRB- |
denotes |
] |
T3691 |
15297-15298 |
. |
denotes |
. |
T3692 |
15298-15412 |
sentence |
denotes |
Amip3 appears to be a homologous to CorC protein which is involved in efflux of magnesium and cobalt in bacteria. |
T3693 |
15299-15304 |
NN |
denotes |
Amip3 |
T3694 |
15305-15312 |
VBZ |
denotes |
appears |
T3695 |
15313-15315 |
TO |
denotes |
to |
T3696 |
15316-15318 |
VB |
denotes |
be |
T3697 |
15319-15320 |
DT |
denotes |
a |
T3698 |
15321-15331 |
JJ |
denotes |
homologous |
T3699 |
15332-15334 |
IN |
denotes |
to |
T3700 |
15335-15339 |
NN |
denotes |
CorC |
T3701 |
15340-15347 |
NN |
denotes |
protein |
T3702 |
15348-15353 |
WDT |
denotes |
which |
T3704 |
15354-15356 |
VBZ |
denotes |
is |
T3703 |
15357-15365 |
VBN |
denotes |
involved |
T3705 |
15366-15368 |
IN |
denotes |
in |
T3706 |
15369-15375 |
NN |
denotes |
efflux |
T3707 |
15376-15378 |
IN |
denotes |
of |
T3708 |
15379-15388 |
NN |
denotes |
magnesium |
T3709 |
15389-15392 |
CC |
denotes |
and |
T3710 |
15393-15399 |
NN |
denotes |
cobalt |
T3711 |
15400-15402 |
IN |
denotes |
in |
T3712 |
15403-15411 |
NNS |
denotes |
bacteria |
T3713 |
15411-15412 |
. |
denotes |
. |
T3714 |
15412-15463 |
sentence |
denotes |
Amip3 mutants confer resistant to copper toxicity. |
T3715 |
15413-15418 |
NN |
denotes |
Amip3 |
T3716 |
15419-15426 |
NNS |
denotes |
mutants |
T3717 |
15427-15433 |
VBP |
denotes |
confer |
T3718 |
15434-15443 |
NN |
denotes |
resistant |
T3719 |
15444-15446 |
IN |
denotes |
to |
T3720 |
15447-15453 |
NN |
denotes |
copper |
T3721 |
15454-15462 |
NN |
denotes |
toxicity |
T3722 |
15462-15463 |
. |
denotes |
. |
T3723 |
15463-15625 |
sentence |
denotes |
Acdp proteins also possess the domains that are found in bacteria CorC and yeast Amip3 proteins, such as the CBS domains, DUF21 domain and transmembrane domains. |
T3724 |
15464-15468 |
NN |
denotes |
Acdp |
T3726 |
15469-15477 |
NN |
denotes |
proteins |
T3727 |
15478-15482 |
RB |
denotes |
also |
T3725 |
15483-15490 |
VBP |
denotes |
possess |
T3728 |
15491-15494 |
DT |
denotes |
the |
T3729 |
15495-15502 |
NNS |
denotes |
domains |
T3730 |
15503-15507 |
WDT |
denotes |
that |
T3732 |
15508-15511 |
VBP |
denotes |
are |
T3731 |
15512-15517 |
VBN |
denotes |
found |
T3733 |
15518-15520 |
IN |
denotes |
in |
T3734 |
15521-15529 |
NNS |
denotes |
bacteria |
T3735 |
15530-15534 |
NN |
denotes |
CorC |
T3737 |
15535-15538 |
CC |
denotes |
and |
T3738 |
15539-15544 |
NN |
denotes |
yeast |
T3739 |
15545-15550 |
NN |
denotes |
Amip3 |
T3736 |
15551-15559 |
NN |
denotes |
proteins |
T3740 |
15559-15561 |
, |
denotes |
, |
T3741 |
15561-15565 |
JJ |
denotes |
such |
T3742 |
15566-15568 |
IN |
denotes |
as |
T3743 |
15569-15572 |
DT |
denotes |
the |
T3745 |
15573-15576 |
NN |
denotes |
CBS |
T3744 |
15577-15584 |
NNS |
denotes |
domains |
T3746 |
15584-15586 |
, |
denotes |
, |
T3747 |
15586-15591 |
NN |
denotes |
DUF21 |
T3748 |
15592-15598 |
NN |
denotes |
domain |
T3749 |
15599-15602 |
CC |
denotes |
and |
T3750 |
15603-15616 |
NN |
denotes |
transmembrane |
T3751 |
15617-15624 |
NNS |
denotes |
domains |
T3752 |
15624-15625 |
. |
denotes |
. |
T3753 |
15625-15769 |
sentence |
denotes |
In addition, a cNMP-binding domain was found in all Acdp proteins, which is usually present in ion channels and cNMP-dependent kinases [10-13]. |
T3754 |
15626-15628 |
IN |
denotes |
In |
T3756 |
15629-15637 |
NN |
denotes |
addition |
T3757 |
15637-15639 |
, |
denotes |
, |
T3758 |
15639-15640 |
DT |
denotes |
a |
T3760 |
15641-15645 |
NN |
denotes |
cNMP |
T3762 |
15645-15646 |
HYPH |
denotes |
- |
T3761 |
15646-15653 |
VBG |
denotes |
binding |
T3759 |
15654-15660 |
NN |
denotes |
domain |
T3763 |
15661-15664 |
VBD |
denotes |
was |
T3755 |
15665-15670 |
VBN |
denotes |
found |
T3764 |
15671-15673 |
IN |
denotes |
in |
T3765 |
15674-15677 |
DT |
denotes |
all |
T3767 |
15678-15682 |
NN |
denotes |
Acdp |
T3766 |
15683-15691 |
NN |
denotes |
proteins |
T3768 |
15691-15693 |
, |
denotes |
, |
T3769 |
15693-15698 |
WDT |
denotes |
which |
T3770 |
15699-15701 |
VBZ |
denotes |
is |
T3771 |
15702-15709 |
RB |
denotes |
usually |
T3772 |
15710-15717 |
JJ |
denotes |
present |
T3773 |
15718-15720 |
IN |
denotes |
in |
T3774 |
15721-15724 |
NN |
denotes |
ion |
T3775 |
15725-15733 |
NNS |
denotes |
channels |
T3776 |
15734-15737 |
CC |
denotes |
and |
T3777 |
15738-15742 |
NN |
denotes |
cNMP |
T3779 |
15742-15743 |
HYPH |
denotes |
- |
T3780 |
15743-15752 |
JJ |
denotes |
dependent |
T3778 |
15753-15760 |
NNS |
denotes |
kinases |
T3781 |
15761-15762 |
-LRB- |
denotes |
[ |
T3782 |
15762-15764 |
CD |
denotes |
10 |
T3783 |
15764-15765 |
SYM |
denotes |
- |
T3784 |
15765-15767 |
CD |
denotes |
13 |
T3785 |
15767-15768 |
-RRB- |
denotes |
] |
T3786 |
15768-15769 |
. |
denotes |
. |
T3787 |
15769-15921 |
sentence |
denotes |
Using antibody produced by Acdp1 C-terminal peptide, we have shown that Acdp1 is predominantly localized on the plasma membrane in hippocampus neurons. |
T3788 |
15770-15775 |
VBG |
denotes |
Using |
T3790 |
15776-15784 |
NN |
denotes |
antibody |
T3791 |
15785-15793 |
VBN |
denotes |
produced |
T3792 |
15794-15796 |
IN |
denotes |
by |
T3793 |
15797-15802 |
NN |
denotes |
Acdp1 |
T3795 |
15803-15804 |
NN |
denotes |
C |
T3797 |
15804-15805 |
HYPH |
denotes |
- |
T3796 |
15805-15813 |
JJ |
denotes |
terminal |
T3794 |
15814-15821 |
NN |
denotes |
peptide |
T3798 |
15821-15823 |
, |
denotes |
, |
T3799 |
15823-15825 |
PRP |
denotes |
we |
T3800 |
15826-15830 |
VBP |
denotes |
have |
T3789 |
15831-15836 |
VBN |
denotes |
shown |
T3801 |
15837-15841 |
IN |
denotes |
that |
T3803 |
15842-15847 |
NN |
denotes |
Acdp1 |
T3804 |
15848-15850 |
VBZ |
denotes |
is |
T3805 |
15851-15864 |
RB |
denotes |
predominantly |
T3802 |
15865-15874 |
VBN |
denotes |
localized |
T3806 |
15875-15877 |
IN |
denotes |
on |
T3807 |
15878-15881 |
DT |
denotes |
the |
T3809 |
15882-15888 |
NN |
denotes |
plasma |
T3808 |
15889-15897 |
NN |
denotes |
membrane |
T3810 |
15898-15900 |
IN |
denotes |
in |
T3811 |
15901-15912 |
NN |
denotes |
hippocampus |
T3812 |
15913-15920 |
NNS |
denotes |
neurons |
T3813 |
15920-15921 |
. |
denotes |
. |
T3814 |
15921-16035 |
sentence |
denotes |
In our previous study, we found human ACDP proteins are predominantly localized in the nucleus in HeLa cells [1]. |
T3815 |
15922-15924 |
IN |
denotes |
In |
T3817 |
15925-15928 |
PRP$ |
denotes |
our |
T3819 |
15929-15937 |
JJ |
denotes |
previous |
T3818 |
15938-15943 |
NN |
denotes |
study |
T3820 |
15943-15945 |
, |
denotes |
, |
T3821 |
15945-15947 |
PRP |
denotes |
we |
T3816 |
15948-15953 |
VBD |
denotes |
found |
T3822 |
15954-15959 |
JJ |
denotes |
human |
T3824 |
15960-15964 |
NN |
denotes |
ACDP |
T3823 |
15965-15973 |
NN |
denotes |
proteins |
T3826 |
15974-15977 |
VBP |
denotes |
are |
T3827 |
15978-15991 |
RB |
denotes |
predominantly |
T3825 |
15992-16001 |
VBN |
denotes |
localized |
T3828 |
16002-16004 |
IN |
denotes |
in |
T3829 |
16005-16008 |
DT |
denotes |
the |
T3830 |
16009-16016 |
NN |
denotes |
nucleus |
T3831 |
16017-16019 |
IN |
denotes |
in |
T3832 |
16020-16024 |
NN |
denotes |
HeLa |
T3833 |
16025-16030 |
NNS |
denotes |
cells |
T3834 |
16031-16032 |
-LRB- |
denotes |
[ |
T3835 |
16032-16033 |
CD |
denotes |
1 |
T3836 |
16033-16034 |
-RRB- |
denotes |
] |
T3837 |
16034-16035 |
. |
denotes |
. |
T3838 |
16035-16223 |
sentence |
denotes |
The discrepancy for Acdp localization in neuronal cells could be caused by non-specificity for previous antibody which was produced by the recombinant ACD domain, or different cells used. |
T3839 |
16036-16039 |
DT |
denotes |
The |
T3840 |
16040-16051 |
NN |
denotes |
discrepancy |
T3842 |
16052-16055 |
IN |
denotes |
for |
T3843 |
16056-16060 |
NN |
denotes |
Acdp |
T3844 |
16061-16073 |
NN |
denotes |
localization |
T3845 |
16074-16076 |
IN |
denotes |
in |
T3846 |
16077-16085 |
JJ |
denotes |
neuronal |
T3847 |
16086-16091 |
NNS |
denotes |
cells |
T3848 |
16092-16097 |
MD |
denotes |
could |
T3849 |
16098-16100 |
VB |
denotes |
be |
T3841 |
16101-16107 |
VBN |
denotes |
caused |
T3850 |
16108-16110 |
IN |
denotes |
by |
T3851 |
16111-16126 |
NN |
denotes |
non-specificity |
T3852 |
16127-16130 |
IN |
denotes |
for |
T3853 |
16131-16139 |
JJ |
denotes |
previous |
T3854 |
16140-16148 |
NN |
denotes |
antibody |
T3855 |
16149-16154 |
WDT |
denotes |
which |
T3857 |
16155-16158 |
VBD |
denotes |
was |
T3856 |
16159-16167 |
VBN |
denotes |
produced |
T3858 |
16168-16170 |
IN |
denotes |
by |
T3859 |
16171-16174 |
DT |
denotes |
the |
T3861 |
16175-16186 |
JJ |
denotes |
recombinant |
T3862 |
16187-16190 |
NN |
denotes |
ACD |
T3860 |
16191-16197 |
NN |
denotes |
domain |
T3863 |
16197-16199 |
, |
denotes |
, |
T3864 |
16199-16201 |
CC |
denotes |
or |
T3865 |
16202-16211 |
JJ |
denotes |
different |
T3866 |
16212-16217 |
NNS |
denotes |
cells |
T3867 |
16218-16222 |
VBN |
denotes |
used |
T3868 |
16222-16223 |
. |
denotes |
. |
T3869 |
16223-16411 |
sentence |
denotes |
In current study, the Acdp1 C-terminus antibody only recognizes Acdp1 in brain tissue extracts as well as in HEK293, 3T3 and PC12 cell lysates, suggesting the specificity of the antibody. |
T3870 |
16224-16226 |
IN |
denotes |
In |
T3872 |
16227-16234 |
JJ |
denotes |
current |
T3873 |
16235-16240 |
NN |
denotes |
study |
T3874 |
16240-16242 |
, |
denotes |
, |
T3875 |
16242-16245 |
DT |
denotes |
the |
T3877 |
16246-16251 |
NN |
denotes |
Acdp1 |
T3878 |
16252-16253 |
NN |
denotes |
C |
T3880 |
16253-16254 |
HYPH |
denotes |
- |
T3879 |
16254-16262 |
NN |
denotes |
terminus |
T3876 |
16263-16271 |
NN |
denotes |
antibody |
T3881 |
16272-16276 |
RB |
denotes |
only |
T3871 |
16277-16287 |
VBZ |
denotes |
recognizes |
T3882 |
16288-16293 |
NN |
denotes |
Acdp1 |
T3883 |
16294-16296 |
IN |
denotes |
in |
T3884 |
16297-16302 |
NN |
denotes |
brain |
T3885 |
16303-16309 |
NN |
denotes |
tissue |
T3886 |
16310-16318 |
NNS |
denotes |
extracts |
T3887 |
16319-16321 |
RB |
denotes |
as |
T3889 |
16322-16326 |
RB |
denotes |
well |
T3888 |
16327-16329 |
IN |
denotes |
as |
T3890 |
16330-16332 |
IN |
denotes |
in |
T3891 |
16333-16339 |
NN |
denotes |
HEK293 |
T3893 |
16339-16341 |
, |
denotes |
, |
T3894 |
16341-16344 |
NN |
denotes |
3T3 |
T3895 |
16345-16348 |
CC |
denotes |
and |
T3896 |
16349-16353 |
NN |
denotes |
PC12 |
T3897 |
16354-16358 |
NN |
denotes |
cell |
T3892 |
16359-16366 |
NNS |
denotes |
lysates |
T3898 |
16366-16368 |
, |
denotes |
, |
T3899 |
16368-16378 |
VBG |
denotes |
suggesting |
T3900 |
16379-16382 |
DT |
denotes |
the |
T3901 |
16383-16394 |
NN |
denotes |
specificity |
T3902 |
16395-16397 |
IN |
denotes |
of |
T3903 |
16398-16401 |
DT |
denotes |
the |
T3904 |
16402-16410 |
NN |
denotes |
antibody |
T3905 |
16410-16411 |
. |
denotes |
. |
T3906 |
16411-16503 |
sentence |
denotes |
Our observations suggested that Acdp might be involved in ion transport in mammalian cells. |
T3907 |
16412-16415 |
PRP$ |
denotes |
Our |
T3908 |
16416-16428 |
NNS |
denotes |
observations |
T3909 |
16429-16438 |
VBD |
denotes |
suggested |
T3910 |
16439-16443 |
IN |
denotes |
that |
T3912 |
16444-16448 |
NN |
denotes |
Acdp |
T3913 |
16449-16454 |
MD |
denotes |
might |
T3914 |
16455-16457 |
VB |
denotes |
be |
T3911 |
16458-16466 |
VBN |
denotes |
involved |
T3915 |
16467-16469 |
IN |
denotes |
in |
T3916 |
16470-16473 |
NN |
denotes |
ion |
T3917 |
16474-16483 |
NN |
denotes |
transport |
T3918 |
16484-16486 |
IN |
denotes |
in |
T3919 |
16487-16496 |
JJ |
denotes |
mammalian |
T3920 |
16497-16502 |
NNS |
denotes |
cells |
T3921 |
16502-16503 |
. |
denotes |
. |
T3922 |
16503-16609 |
sentence |
denotes |
However, more detailed functional studies are needed to demonstrate the real functions of these proteins. |
T3923 |
16504-16511 |
RB |
denotes |
However |
T3925 |
16511-16513 |
, |
denotes |
, |
T3926 |
16513-16517 |
RBR |
denotes |
more |
T3927 |
16518-16526 |
JJ |
denotes |
detailed |
T3929 |
16527-16537 |
JJ |
denotes |
functional |
T3928 |
16538-16545 |
NNS |
denotes |
studies |
T3930 |
16546-16549 |
VBP |
denotes |
are |
T3924 |
16550-16556 |
VBN |
denotes |
needed |
T3931 |
16557-16559 |
TO |
denotes |
to |
T3932 |
16560-16571 |
VB |
denotes |
demonstrate |
T3933 |
16572-16575 |
DT |
denotes |
the |
T3935 |
16576-16580 |
JJ |
denotes |
real |
T3934 |
16581-16590 |
NNS |
denotes |
functions |
T3936 |
16591-16593 |
IN |
denotes |
of |
T3937 |
16594-16599 |
DT |
denotes |
these |
T3938 |
16600-16608 |
NN |
denotes |
proteins |
T3939 |
16608-16609 |
. |
denotes |
. |
T4051 |
16623-16626 |
PRP$ |
denotes |
Our |
T4053 |
16627-16635 |
JJ |
denotes |
previous |
T4052 |
16636-16640 |
NN |
denotes |
work |
T4055 |
16641-16644 |
VBZ |
denotes |
has |
T4054 |
16645-16654 |
VBN |
denotes |
described |
T4056 |
16655-16660 |
JJ |
denotes |
human |
T4058 |
16661-16665 |
NN |
denotes |
ACDP |
T4057 |
16666-16671 |
NNS |
denotes |
genes |
T4059 |
16672-16673 |
-LRB- |
denotes |
[ |
T4060 |
16673-16674 |
CD |
denotes |
1 |
T4061 |
16674-16675 |
-RRB- |
denotes |
] |
T4062 |
16675-16676 |
. |
denotes |
. |
T4063 |
16676-16944 |
sentence |
denotes |
The new information of the current work includes: 1). It is the first time to report the existence of multiple Acdp genes in other mammals in addition to human, while Acdp appears to be a single copy gene in lower organisms such as in C. elegans, yeasts and bacteria. |
T4064 |
16677-16680 |
DT |
denotes |
The |
T4066 |
16681-16684 |
JJ |
denotes |
new |
T4065 |
16685-16696 |
NN |
denotes |
information |
T4068 |
16697-16699 |
IN |
denotes |
of |
T4069 |
16700-16703 |
DT |
denotes |
the |
T4071 |
16704-16711 |
JJ |
denotes |
current |
T4070 |
16712-16716 |
NN |
denotes |
work |
T4067 |
16717-16725 |
VBZ |
denotes |
includes |
T4073 |
16725-16727 |
: |
denotes |
: |
T4074 |
16727-16728 |
LS |
denotes |
1 |
T4075 |
16728-16729 |
-RRB- |
denotes |
) |
T4076 |
16729-16730 |
, |
denotes |
. |
T4077 |
16731-16733 |
PRP |
denotes |
It |
T4072 |
16734-16736 |
VBZ |
denotes |
is |
T4078 |
16737-16740 |
DT |
denotes |
the |
T4080 |
16741-16746 |
JJ |
denotes |
first |
T4079 |
16747-16751 |
NN |
denotes |
time |
T4081 |
16752-16754 |
TO |
denotes |
to |
T4082 |
16755-16761 |
VB |
denotes |
report |
T4083 |
16762-16765 |
DT |
denotes |
the |
T4084 |
16766-16775 |
NN |
denotes |
existence |
T4085 |
16776-16778 |
IN |
denotes |
of |
T4086 |
16779-16787 |
JJ |
denotes |
multiple |
T4088 |
16788-16792 |
NN |
denotes |
Acdp |
T4087 |
16793-16798 |
NNS |
denotes |
genes |
T4089 |
16799-16801 |
IN |
denotes |
in |
T4090 |
16802-16807 |
JJ |
denotes |
other |
T4091 |
16808-16815 |
NNS |
denotes |
mammals |
T4092 |
16816-16818 |
IN |
denotes |
in |
T4093 |
16819-16827 |
NN |
denotes |
addition |
T4094 |
16828-16830 |
IN |
denotes |
to |
T4095 |
16831-16836 |
NN |
denotes |
human |
T4096 |
16836-16838 |
, |
denotes |
, |
T4097 |
16838-16843 |
IN |
denotes |
while |
T4099 |
16844-16848 |
NN |
denotes |
Acdp |
T4098 |
16849-16856 |
VBZ |
denotes |
appears |
T4100 |
16857-16859 |
TO |
denotes |
to |
T4101 |
16860-16862 |
VB |
denotes |
be |
T4102 |
16863-16864 |
DT |
denotes |
a |
T4104 |
16865-16871 |
JJ |
denotes |
single |
T4105 |
16872-16876 |
NN |
denotes |
copy |
T4103 |
16877-16881 |
NN |
denotes |
gene |
T4106 |
16882-16884 |
IN |
denotes |
in |
T4107 |
16885-16890 |
JJR |
denotes |
lower |
T4108 |
16891-16900 |
NNS |
denotes |
organisms |
T4109 |
16901-16905 |
JJ |
denotes |
such |
T4110 |
16906-16908 |
IN |
denotes |
as |
T4111 |
16909-16911 |
IN |
denotes |
in |
T4112 |
16912-16914 |
NNP |
denotes |
C. |
T4113 |
16915-16922 |
NNP |
denotes |
elegans |
T4114 |
16922-16924 |
, |
denotes |
, |
T4115 |
16924-16930 |
NNS |
denotes |
yeasts |
T4116 |
16931-16934 |
CC |
denotes |
and |
T4117 |
16935-16943 |
NNS |
denotes |
bacteria |
T4118 |
16943-16944 |
. |
denotes |
. |
T4119 |
16944-17572 |
sentence |
denotes |
We have also suggested the evolutionary relationships of Acdp genes in different species (phylogenetic tree); 2). Molecular cloning and characterization of murine Acdp gene family are essential for study of this novel gene family in animal model, e.g. for generation of knockout or transgenic models; 3). We have demonstrated both DNA and amino acid conservations between mouse and human for each Acdp gene and the whole Acdp gene family, which provide important information for the possibility of functional redundancy or overlap between Acdp members; 4). We have generated antibodies specific for Acdp1 and all Acdp proteins. |
T4120 |
16945-16947 |
PRP |
denotes |
We |
T4122 |
16948-16952 |
VBP |
denotes |
have |
T4123 |
16953-16957 |
RB |
denotes |
also |
T4121 |
16958-16967 |
VBN |
denotes |
suggested |
T4125 |
16968-16971 |
DT |
denotes |
the |
T4127 |
16972-16984 |
JJ |
denotes |
evolutionary |
T4126 |
16985-16998 |
NNS |
denotes |
relationships |
T4128 |
16999-17001 |
IN |
denotes |
of |
T4129 |
17002-17006 |
NN |
denotes |
Acdp |
T4130 |
17007-17012 |
NNS |
denotes |
genes |
T4131 |
17013-17015 |
IN |
denotes |
in |
T4132 |
17016-17025 |
JJ |
denotes |
different |
T4133 |
17026-17033 |
NNS |
denotes |
species |
T4134 |
17034-17035 |
-LRB- |
denotes |
( |
T4136 |
17035-17047 |
JJ |
denotes |
phylogenetic |
T4135 |
17048-17052 |
NN |
denotes |
tree |
T4137 |
17052-17053 |
-RRB- |
denotes |
) |
T4138 |
17053-17054 |
: |
denotes |
; |
T4139 |
17055-17056 |
LS |
denotes |
2 |
T4141 |
17056-17057 |
-RRB- |
denotes |
) |
T4142 |
17057-17058 |
, |
denotes |
. |
T4143 |
17059-17068 |
JJ |
denotes |
Molecular |
T4144 |
17069-17076 |
NN |
denotes |
cloning |
T4145 |
17077-17080 |
CC |
denotes |
and |
T4146 |
17081-17097 |
NN |
denotes |
characterization |
T4147 |
17098-17100 |
IN |
denotes |
of |
T4148 |
17101-17107 |
JJ |
denotes |
murine |
T4150 |
17108-17112 |
NN |
denotes |
Acdp |
T4151 |
17113-17117 |
NN |
denotes |
gene |
T4149 |
17118-17124 |
NN |
denotes |
family |
T4140 |
17125-17128 |
VBP |
denotes |
are |
T4152 |
17129-17138 |
JJ |
denotes |
essential |
T4153 |
17139-17142 |
IN |
denotes |
for |
T4154 |
17143-17148 |
NN |
denotes |
study |
T4155 |
17149-17151 |
IN |
denotes |
of |
T4156 |
17152-17156 |
DT |
denotes |
this |
T4158 |
17157-17162 |
JJ |
denotes |
novel |
T4159 |
17163-17167 |
NN |
denotes |
gene |
T4157 |
17168-17174 |
NN |
denotes |
family |
T4160 |
17175-17177 |
IN |
denotes |
in |
T4161 |
17178-17184 |
NN |
denotes |
animal |
T4162 |
17185-17190 |
NN |
denotes |
model |
T4163 |
17190-17192 |
, |
denotes |
, |
T4164 |
17192-17196 |
FW |
denotes |
e.g. |
T4165 |
17197-17200 |
IN |
denotes |
for |
T4166 |
17201-17211 |
NN |
denotes |
generation |
T4167 |
17212-17214 |
IN |
denotes |
of |
T4168 |
17215-17223 |
NN |
denotes |
knockout |
T4170 |
17224-17226 |
CC |
denotes |
or |
T4171 |
17227-17237 |
JJ |
denotes |
transgenic |
T4169 |
17238-17244 |
NNS |
denotes |
models |
T4172 |
17244-17245 |
: |
denotes |
; |
T4173 |
17246-17247 |
LS |
denotes |
3 |
T4175 |
17247-17248 |
-RRB- |
denotes |
) |
T4176 |
17248-17249 |
, |
denotes |
. |
T4177 |
17250-17252 |
PRP |
denotes |
We |
T4178 |
17253-17257 |
VBP |
denotes |
have |
T4174 |
17258-17270 |
VBN |
denotes |
demonstrated |
T4179 |
17271-17275 |
CC |
denotes |
both |
T4180 |
17276-17279 |
NN |
denotes |
DNA |
T4182 |
17280-17283 |
CC |
denotes |
and |
T4183 |
17284-17289 |
NN |
denotes |
amino |
T4184 |
17290-17294 |
NN |
denotes |
acid |
T4181 |
17295-17308 |
NNS |
denotes |
conservations |
T4185 |
17309-17316 |
IN |
denotes |
between |
T4186 |
17317-17322 |
NN |
denotes |
mouse |
T4187 |
17323-17326 |
CC |
denotes |
and |
T4188 |
17327-17332 |
NN |
denotes |
human |
T4189 |
17333-17336 |
IN |
denotes |
for |
T4190 |
17337-17341 |
DT |
denotes |
each |
T4192 |
17342-17346 |
NN |
denotes |
Acdp |
T4191 |
17347-17351 |
NN |
denotes |
gene |
T4193 |
17352-17355 |
CC |
denotes |
and |
T4194 |
17356-17359 |
DT |
denotes |
the |
T4196 |
17360-17365 |
JJ |
denotes |
whole |
T4197 |
17366-17370 |
NN |
denotes |
Acdp |
T4198 |
17371-17375 |
NN |
denotes |
gene |
T4195 |
17376-17382 |
NN |
denotes |
family |
T4199 |
17382-17384 |
, |
denotes |
, |
T4200 |
17384-17389 |
WDT |
denotes |
which |
T4201 |
17390-17397 |
VBP |
denotes |
provide |
T4202 |
17398-17407 |
JJ |
denotes |
important |
T4203 |
17408-17419 |
NN |
denotes |
information |
T4204 |
17420-17423 |
IN |
denotes |
for |
T4205 |
17424-17427 |
DT |
denotes |
the |
T4206 |
17428-17439 |
NN |
denotes |
possibility |
T4207 |
17440-17442 |
IN |
denotes |
of |
T4208 |
17443-17453 |
JJ |
denotes |
functional |
T4209 |
17454-17464 |
NN |
denotes |
redundancy |
T4210 |
17465-17467 |
CC |
denotes |
or |
T4211 |
17468-17475 |
NN |
denotes |
overlap |
T4212 |
17476-17483 |
IN |
denotes |
between |
T4213 |
17484-17488 |
NN |
denotes |
Acdp |
T4214 |
17489-17496 |
NNS |
denotes |
members |
T4215 |
17496-17497 |
: |
denotes |
; |
T4216 |
17498-17499 |
LS |
denotes |
4 |
T4217 |
17499-17500 |
-RRB- |
denotes |
) |
T4218 |
17500-17501 |
, |
denotes |
. |
T4219 |
17502-17504 |
PRP |
denotes |
We |
T4220 |
17505-17509 |
VBP |
denotes |
have |
T4124 |
17510-17519 |
VBN |
denotes |
generated |
T4221 |
17520-17530 |
NNS |
denotes |
antibodies |
T4222 |
17531-17539 |
JJ |
denotes |
specific |
T4223 |
17540-17543 |
IN |
denotes |
for |
T4224 |
17544-17549 |
NN |
denotes |
Acdp1 |
T4225 |
17550-17553 |
CC |
denotes |
and |
T4226 |
17554-17557 |
DT |
denotes |
all |
T4228 |
17558-17562 |
NN |
denotes |
Acdp |
T4227 |
17563-17571 |
NN |
denotes |
proteins |
T4229 |
17571-17572 |
. |
denotes |
. |
T4230 |
17572-17643 |
sentence |
denotes |
The Acdp1 C-terminus antibody appears to specifically recognize Acdp1. |
T4231 |
17573-17576 |
DT |
denotes |
The |
T4233 |
17577-17582 |
NN |
denotes |
Acdp1 |
T4234 |
17583-17584 |
NN |
denotes |
C |
T4236 |
17584-17585 |
HYPH |
denotes |
- |
T4235 |
17585-17593 |
NN |
denotes |
terminus |
T4232 |
17594-17602 |
NN |
denotes |
antibody |
T4237 |
17603-17610 |
VBZ |
denotes |
appears |
T4238 |
17611-17613 |
TO |
denotes |
to |
T4240 |
17614-17626 |
RB |
denotes |
specifically |
T4239 |
17627-17636 |
VB |
denotes |
recognize |
T4241 |
17637-17642 |
NN |
denotes |
Acdp1 |
T4242 |
17642-17643 |
. |
denotes |
. |
T4243 |
17643-17770 |
sentence |
denotes |
Using this antibody, we have demonstrated that Acdp1 is predominantly localized on the plasma membrane in hippocampus neurons. |
T4244 |
17644-17649 |
VBG |
denotes |
Using |
T4246 |
17650-17654 |
DT |
denotes |
this |
T4247 |
17655-17663 |
NN |
denotes |
antibody |
T4248 |
17663-17665 |
, |
denotes |
, |
T4249 |
17665-17667 |
PRP |
denotes |
we |
T4250 |
17668-17672 |
VBP |
denotes |
have |
T4245 |
17673-17685 |
VBN |
denotes |
demonstrated |
T4251 |
17686-17690 |
IN |
denotes |
that |
T4253 |
17691-17696 |
NN |
denotes |
Acdp1 |
T4254 |
17697-17699 |
VBZ |
denotes |
is |
T4255 |
17700-17713 |
RB |
denotes |
predominantly |
T4252 |
17714-17723 |
VBN |
denotes |
localized |
T4256 |
17724-17726 |
IN |
denotes |
on |
T4257 |
17727-17730 |
DT |
denotes |
the |
T4259 |
17731-17737 |
NN |
denotes |
plasma |
T4258 |
17738-17746 |
NN |
denotes |
membrane |
T4260 |
17747-17749 |
IN |
denotes |
in |
T4261 |
17750-17761 |
NN |
denotes |
hippocampus |
T4262 |
17762-17769 |
NNS |
denotes |
neurons |
T4263 |
17769-17770 |
. |
denotes |
. |
T4264 |
17770-17880 |
sentence |
denotes |
These results represent an important step towards the characterization of functions for the Acdp gene family. |
T4265 |
17771-17776 |
DT |
denotes |
These |
T4266 |
17777-17784 |
NNS |
denotes |
results |
T4267 |
17785-17794 |
VBP |
denotes |
represent |
T4268 |
17795-17797 |
DT |
denotes |
an |
T4270 |
17798-17807 |
JJ |
denotes |
important |
T4269 |
17808-17812 |
NN |
denotes |
step |
T4271 |
17813-17820 |
IN |
denotes |
towards |
T4272 |
17821-17824 |
DT |
denotes |
the |
T4273 |
17825-17841 |
NN |
denotes |
characterization |
T4274 |
17842-17844 |
IN |
denotes |
of |
T4275 |
17845-17854 |
NNS |
denotes |
functions |
T4276 |
17855-17858 |
IN |
denotes |
for |
T4277 |
17859-17862 |
DT |
denotes |
the |
T4279 |
17863-17867 |
NN |
denotes |
Acdp |
T4280 |
17868-17872 |
NN |
denotes |
gene |
T4278 |
17873-17879 |
NN |
denotes |
family |
T4281 |
17879-17880 |
. |
denotes |
. |
T4392 |
17891-17895 |
NN |
denotes |
cDNA |
T4393 |
17896-17903 |
NN |
denotes |
cloning |
T4394 |
17903-18017 |
sentence |
denotes |
cDNA cloning of the Acdp gene family was performed based on human homologue sequences as previously reported [2]. |
T4395 |
17904-17908 |
NN |
denotes |
cDNA |
T4396 |
17909-17916 |
NN |
denotes |
cloning |
T4398 |
17917-17919 |
IN |
denotes |
of |
T4399 |
17920-17923 |
DT |
denotes |
the |
T4401 |
17924-17928 |
NN |
denotes |
Acdp |
T4402 |
17929-17933 |
NN |
denotes |
gene |
T4400 |
17934-17940 |
NN |
denotes |
family |
T4403 |
17941-17944 |
VBD |
denotes |
was |
T4397 |
17945-17954 |
VBN |
denotes |
performed |
T4404 |
17955-17960 |
VBN |
denotes |
based |
T4405 |
17961-17963 |
IN |
denotes |
on |
T4406 |
17964-17969 |
JJ |
denotes |
human |
T4408 |
17970-17979 |
NN |
denotes |
homologue |
T4407 |
17980-17989 |
NNS |
denotes |
sequences |
T4409 |
17990-17992 |
IN |
denotes |
as |
T4411 |
17993-18003 |
RB |
denotes |
previously |
T4410 |
18004-18012 |
VBN |
denotes |
reported |
T4412 |
18013-18014 |
-LRB- |
denotes |
[ |
T4413 |
18014-18015 |
CD |
denotes |
2 |
T4414 |
18015-18016 |
-RRB- |
denotes |
] |
T4415 |
18016-18017 |
. |
denotes |
. |
T4416 |
18017-18168 |
sentence |
denotes |
Briefly, the human ACDP cDNAs and predicted AA sequences were used to search the mouse EST database for EST markers corresponding to each Acdp member. |
T4417 |
18018-18025 |
RB |
denotes |
Briefly |
T4419 |
18025-18027 |
, |
denotes |
, |
T4420 |
18027-18030 |
DT |
denotes |
the |
T4422 |
18031-18036 |
JJ |
denotes |
human |
T4423 |
18037-18041 |
NN |
denotes |
ACDP |
T4421 |
18042-18047 |
NNS |
denotes |
cDNAs |
T4424 |
18048-18051 |
CC |
denotes |
and |
T4425 |
18052-18061 |
VBN |
denotes |
predicted |
T4427 |
18062-18064 |
NN |
denotes |
AA |
T4426 |
18065-18074 |
NNS |
denotes |
sequences |
T4428 |
18075-18079 |
VBD |
denotes |
were |
T4418 |
18080-18084 |
VBN |
denotes |
used |
T4429 |
18085-18087 |
TO |
denotes |
to |
T4430 |
18088-18094 |
VB |
denotes |
search |
T4431 |
18095-18098 |
DT |
denotes |
the |
T4433 |
18099-18104 |
NN |
denotes |
mouse |
T4434 |
18105-18108 |
NN |
denotes |
EST |
T4432 |
18109-18117 |
NN |
denotes |
database |
T4435 |
18118-18121 |
IN |
denotes |
for |
T4436 |
18122-18125 |
NN |
denotes |
EST |
T4437 |
18126-18133 |
NNS |
denotes |
markers |
T4438 |
18134-18147 |
VBG |
denotes |
corresponding |
T4439 |
18148-18150 |
IN |
denotes |
to |
T4440 |
18151-18155 |
DT |
denotes |
each |
T4442 |
18156-18160 |
NN |
denotes |
Acdp |
T4441 |
18161-18167 |
NN |
denotes |
member |
T4443 |
18167-18168 |
. |
denotes |
. |
T4444 |
18168-18407 |
sentence |
denotes |
A forward primer within the human ACDP 5' cDNA coding region (after start codon) and a mouse reverse primer from the mouse EST marker were used to amplify the homologue sequence from mouse cDNA at very low annealing temperature (45–50°C). |
T4445 |
18169-18170 |
DT |
denotes |
A |
T4447 |
18171-18178 |
JJ |
denotes |
forward |
T4446 |
18179-18185 |
NN |
denotes |
primer |
T4449 |
18186-18192 |
IN |
denotes |
within |
T4450 |
18193-18196 |
DT |
denotes |
the |
T4452 |
18197-18202 |
JJ |
denotes |
human |
T4453 |
18203-18207 |
NN |
denotes |
ACDP |
T4454 |
18208-18209 |
CD |
denotes |
5 |
T4455 |
18209-18210 |
SYM |
denotes |
' |
T4456 |
18211-18215 |
NN |
denotes |
cDNA |
T4457 |
18216-18222 |
NN |
denotes |
coding |
T4451 |
18223-18229 |
NN |
denotes |
region |
T4458 |
18230-18231 |
-LRB- |
denotes |
( |
T4459 |
18231-18236 |
IN |
denotes |
after |
T4460 |
18237-18242 |
NN |
denotes |
start |
T4461 |
18243-18248 |
NN |
denotes |
codon |
T4462 |
18248-18249 |
-RRB- |
denotes |
) |
T4463 |
18250-18253 |
CC |
denotes |
and |
T4464 |
18254-18255 |
DT |
denotes |
a |
T4466 |
18256-18261 |
NN |
denotes |
mouse |
T4467 |
18262-18269 |
JJ |
denotes |
reverse |
T4465 |
18270-18276 |
NN |
denotes |
primer |
T4468 |
18277-18281 |
IN |
denotes |
from |
T4469 |
18282-18285 |
DT |
denotes |
the |
T4471 |
18286-18291 |
NN |
denotes |
mouse |
T4472 |
18292-18295 |
NN |
denotes |
EST |
T4470 |
18296-18302 |
NN |
denotes |
marker |
T4473 |
18303-18307 |
VBD |
denotes |
were |
T4448 |
18308-18312 |
VBN |
denotes |
used |
T4474 |
18313-18315 |
TO |
denotes |
to |
T4475 |
18316-18323 |
VB |
denotes |
amplify |
T4476 |
18324-18327 |
DT |
denotes |
the |
T4478 |
18328-18337 |
NN |
denotes |
homologue |
T4477 |
18338-18346 |
NN |
denotes |
sequence |
T4479 |
18347-18351 |
IN |
denotes |
from |
T4480 |
18352-18357 |
NN |
denotes |
mouse |
T4481 |
18358-18362 |
NN |
denotes |
cDNA |
T4482 |
18363-18365 |
IN |
denotes |
at |
T4483 |
18366-18370 |
RB |
denotes |
very |
T4484 |
18371-18374 |
JJ |
denotes |
low |
T4486 |
18375-18384 |
VBG |
denotes |
annealing |
T4485 |
18385-18396 |
NN |
denotes |
temperature |
T4487 |
18397-18398 |
-LRB- |
denotes |
( |
T4488 |
18398-18400 |
CD |
denotes |
45 |
T4490 |
18400-18401 |
SYM |
denotes |
– |
T4489 |
18401-18403 |
CD |
denotes |
50 |
T4491 |
18403-18405 |
NN |
denotes |
°C |
T4492 |
18405-18406 |
-RRB- |
denotes |
) |
T4493 |
18406-18407 |
. |
denotes |
. |
T4494 |
18407-18641 |
sentence |
denotes |
A nested PCR using an inside reverse primer from the mouse EST sequence and the same human forward primer was then carried out to amplify the specific mouse gene from the first round PCR products at high annealing temperature (62°C). |
T4495 |
18408-18409 |
DT |
denotes |
A |
T4497 |
18410-18416 |
JJ |
denotes |
nested |
T4496 |
18417-18420 |
NN |
denotes |
PCR |
T4499 |
18421-18426 |
VBG |
denotes |
using |
T4500 |
18427-18429 |
DT |
denotes |
an |
T4502 |
18430-18436 |
JJ |
denotes |
inside |
T4503 |
18437-18444 |
JJ |
denotes |
reverse |
T4501 |
18445-18451 |
NN |
denotes |
primer |
T4504 |
18452-18456 |
IN |
denotes |
from |
T4505 |
18457-18460 |
DT |
denotes |
the |
T4507 |
18461-18466 |
NN |
denotes |
mouse |
T4508 |
18467-18470 |
NN |
denotes |
EST |
T4506 |
18471-18479 |
NN |
denotes |
sequence |
T4509 |
18480-18483 |
CC |
denotes |
and |
T4510 |
18484-18487 |
DT |
denotes |
the |
T4512 |
18488-18492 |
JJ |
denotes |
same |
T4513 |
18493-18498 |
JJ |
denotes |
human |
T4514 |
18499-18506 |
JJ |
denotes |
forward |
T4511 |
18507-18513 |
NN |
denotes |
primer |
T4515 |
18514-18517 |
VBD |
denotes |
was |
T4516 |
18518-18522 |
RB |
denotes |
then |
T4498 |
18523-18530 |
VBN |
denotes |
carried |
T4517 |
18531-18534 |
RP |
denotes |
out |
T4518 |
18535-18537 |
TO |
denotes |
to |
T4519 |
18538-18545 |
VB |
denotes |
amplify |
T4520 |
18546-18549 |
DT |
denotes |
the |
T4522 |
18550-18558 |
JJ |
denotes |
specific |
T4523 |
18559-18564 |
NN |
denotes |
mouse |
T4521 |
18565-18569 |
NN |
denotes |
gene |
T4524 |
18570-18574 |
IN |
denotes |
from |
T4525 |
18575-18578 |
DT |
denotes |
the |
T4527 |
18579-18584 |
JJ |
denotes |
first |
T4528 |
18585-18590 |
NN |
denotes |
round |
T4529 |
18591-18594 |
NN |
denotes |
PCR |
T4526 |
18595-18603 |
NNS |
denotes |
products |
T4530 |
18604-18606 |
IN |
denotes |
at |
T4531 |
18607-18611 |
JJ |
denotes |
high |
T4533 |
18612-18621 |
VBG |
denotes |
annealing |
T4532 |
18622-18633 |
NN |
denotes |
temperature |
T4534 |
18634-18635 |
-LRB- |
denotes |
( |
T4535 |
18635-18637 |
CD |
denotes |
62 |
T4536 |
18637-18639 |
NN |
denotes |
°C |
T4537 |
18639-18640 |
-RRB- |
denotes |
) |
T4538 |
18640-18641 |
. |
denotes |
. |
T4539 |
18641-18754 |
sentence |
denotes |
The expected PCR products were directly excised from agarose gel and sequenced by an ABI377 automatic sequencer. |
T4540 |
18642-18645 |
DT |
denotes |
The |
T4542 |
18646-18654 |
JJ |
denotes |
expected |
T4543 |
18655-18658 |
NN |
denotes |
PCR |
T4541 |
18659-18667 |
NNS |
denotes |
products |
T4545 |
18668-18672 |
VBD |
denotes |
were |
T4546 |
18673-18681 |
RB |
denotes |
directly |
T4544 |
18682-18689 |
VBN |
denotes |
excised |
T4547 |
18690-18694 |
IN |
denotes |
from |
T4548 |
18695-18702 |
NN |
denotes |
agarose |
T4549 |
18703-18706 |
NN |
denotes |
gel |
T4550 |
18707-18710 |
CC |
denotes |
and |
T4551 |
18711-18720 |
VBN |
denotes |
sequenced |
T4552 |
18721-18723 |
IN |
denotes |
by |
T4553 |
18724-18726 |
DT |
denotes |
an |
T4555 |
18727-18733 |
NN |
denotes |
ABI377 |
T4556 |
18734-18743 |
JJ |
denotes |
automatic |
T4554 |
18744-18753 |
NN |
denotes |
sequencer |
T4557 |
18753-18754 |
. |
denotes |
. |
T4558 |
18754-18885 |
sentence |
denotes |
The sequence was further confirmed using a forward primer from newly identified sequence and a reverse primer from known sequence. |
T4559 |
18755-18758 |
DT |
denotes |
The |
T4560 |
18759-18767 |
NN |
denotes |
sequence |
T4562 |
18768-18771 |
VBD |
denotes |
was |
T4563 |
18772-18779 |
RB |
denotes |
further |
T4561 |
18780-18789 |
VBN |
denotes |
confirmed |
T4564 |
18790-18795 |
VBG |
denotes |
using |
T4565 |
18796-18797 |
DT |
denotes |
a |
T4567 |
18798-18805 |
JJ |
denotes |
forward |
T4566 |
18806-18812 |
NN |
denotes |
primer |
T4568 |
18813-18817 |
IN |
denotes |
from |
T4569 |
18818-18823 |
RB |
denotes |
newly |
T4570 |
18824-18834 |
VBN |
denotes |
identified |
T4571 |
18835-18843 |
NN |
denotes |
sequence |
T4572 |
18844-18847 |
CC |
denotes |
and |
T4573 |
18848-18849 |
DT |
denotes |
a |
T4575 |
18850-18857 |
JJ |
denotes |
reverse |
T4574 |
18858-18864 |
NN |
denotes |
primer |
T4576 |
18865-18869 |
IN |
denotes |
from |
T4577 |
18870-18875 |
JJ |
denotes |
known |
T4578 |
18876-18884 |
NN |
denotes |
sequence |
T4579 |
18884-18885 |
. |
denotes |
. |
T4580 |
18885-19025 |
sentence |
denotes |
Once most of the coding sequences were identified, partial sequence of exon 1 and the 5' UTR sequences were obtained by BAC DNA sequencing. |
T4581 |
18886-18890 |
IN |
denotes |
Once |
T4583 |
18891-18895 |
JJS |
denotes |
most |
T4584 |
18896-18898 |
IN |
denotes |
of |
T4585 |
18899-18902 |
DT |
denotes |
the |
T4587 |
18903-18909 |
VBG |
denotes |
coding |
T4586 |
18910-18919 |
NNS |
denotes |
sequences |
T4588 |
18920-18924 |
VBD |
denotes |
were |
T4582 |
18925-18935 |
VBN |
denotes |
identified |
T4590 |
18935-18937 |
, |
denotes |
, |
T4591 |
18937-18944 |
JJ |
denotes |
partial |
T4592 |
18945-18953 |
NN |
denotes |
sequence |
T4593 |
18954-18956 |
IN |
denotes |
of |
T4594 |
18957-18961 |
NN |
denotes |
exon |
T4596 |
18962-18963 |
CD |
denotes |
1 |
T4597 |
18964-18967 |
CC |
denotes |
and |
T4598 |
18968-18971 |
DT |
denotes |
the |
T4600 |
18972-18973 |
CD |
denotes |
5 |
T4601 |
18973-18974 |
SYM |
denotes |
' |
T4599 |
18975-18978 |
NN |
denotes |
UTR |
T4595 |
18979-18988 |
NNS |
denotes |
sequences |
T4602 |
18989-18993 |
VBD |
denotes |
were |
T4589 |
18994-19002 |
VBN |
denotes |
obtained |
T4603 |
19003-19005 |
IN |
denotes |
by |
T4604 |
19006-19009 |
NN |
denotes |
BAC |
T4606 |
19010-19013 |
NN |
denotes |
DNA |
T4605 |
19014-19024 |
NN |
denotes |
sequencing |
T4607 |
19024-19025 |
. |
denotes |
. |
T4647 |
19027-19035 |
NNP |
denotes |
Northern |
T4648 |
19036-19040 |
NN |
denotes |
blot |
T4649 |
19041-19049 |
NNS |
denotes |
analyses |
T4650 |
19049-19154 |
sentence |
denotes |
Multiple Choice Northern Blot filters containing 12 different mouse tissues were purchased from Origene. |
T4651 |
19050-19058 |
JJ |
denotes |
Multiple |
T4653 |
19059-19065 |
NN |
denotes |
Choice |
T4654 |
19066-19074 |
NNP |
denotes |
Northern |
T4655 |
19075-19079 |
NN |
denotes |
Blot |
T4652 |
19080-19087 |
NNS |
denotes |
filters |
T4657 |
19088-19098 |
VBG |
denotes |
containing |
T4658 |
19099-19101 |
CD |
denotes |
12 |
T4660 |
19102-19111 |
JJ |
denotes |
different |
T4661 |
19112-19117 |
NN |
denotes |
mouse |
T4659 |
19118-19125 |
NNS |
denotes |
tissues |
T4662 |
19126-19130 |
VBD |
denotes |
were |
T4656 |
19131-19140 |
VBN |
denotes |
purchased |
T4663 |
19141-19145 |
IN |
denotes |
from |
T4664 |
19146-19153 |
NNP |
denotes |
Origene |
T4665 |
19153-19154 |
. |
denotes |
. |
T4666 |
19154-19365 |
sentence |
denotes |
The filters were probed for each Acdp gene with a PCR fragment (around 350 bp) from last exon and the 3' untranslated region labeled with α-32P dCTP using the random primer extension system (Life Technologies). |
T4667 |
19155-19158 |
DT |
denotes |
The |
T4668 |
19159-19166 |
NNS |
denotes |
filters |
T4670 |
19167-19171 |
VBD |
denotes |
were |
T4669 |
19172-19178 |
VBN |
denotes |
probed |
T4671 |
19179-19182 |
IN |
denotes |
for |
T4672 |
19183-19187 |
DT |
denotes |
each |
T4674 |
19188-19192 |
NN |
denotes |
Acdp |
T4673 |
19193-19197 |
NN |
denotes |
gene |
T4675 |
19198-19202 |
IN |
denotes |
with |
T4676 |
19203-19204 |
DT |
denotes |
a |
T4678 |
19205-19208 |
NN |
denotes |
PCR |
T4677 |
19209-19217 |
NN |
denotes |
fragment |
T4679 |
19218-19219 |
-LRB- |
denotes |
( |
T4681 |
19219-19225 |
IN |
denotes |
around |
T4682 |
19226-19229 |
CD |
denotes |
350 |
T4680 |
19230-19232 |
NN |
denotes |
bp |
T4683 |
19232-19233 |
-RRB- |
denotes |
) |
T4684 |
19234-19238 |
IN |
denotes |
from |
T4685 |
19239-19243 |
JJ |
denotes |
last |
T4686 |
19244-19248 |
NN |
denotes |
exon |
T4687 |
19249-19252 |
CC |
denotes |
and |
T4688 |
19253-19256 |
DT |
denotes |
the |
T4689 |
19257-19258 |
CD |
denotes |
3 |
T4691 |
19258-19259 |
SYM |
denotes |
' |
T4692 |
19260-19272 |
JJ |
denotes |
untranslated |
T4690 |
19273-19279 |
NN |
denotes |
region |
T4693 |
19280-19287 |
VBN |
denotes |
labeled |
T4694 |
19288-19292 |
IN |
denotes |
with |
T4695 |
19293-19294 |
NN |
denotes |
α |
T4697 |
19294-19295 |
HYPH |
denotes |
- |
T4696 |
19295-19298 |
NN |
denotes |
32P |
T4698 |
19299-19303 |
NN |
denotes |
dCTP |
T4699 |
19304-19309 |
VBG |
denotes |
using |
T4700 |
19310-19313 |
DT |
denotes |
the |
T4702 |
19314-19320 |
JJ |
denotes |
random |
T4703 |
19321-19327 |
NN |
denotes |
primer |
T4704 |
19328-19337 |
NN |
denotes |
extension |
T4701 |
19338-19344 |
NN |
denotes |
system |
T4705 |
19345-19346 |
-LRB- |
denotes |
( |
T4707 |
19346-19350 |
NNP |
denotes |
Life |
T4706 |
19351-19363 |
NNP |
denotes |
Technologies |
T4708 |
19363-19364 |
-RRB- |
denotes |
) |
T4709 |
19364-19365 |
. |
denotes |
. |
T4710 |
19365-19408 |
sentence |
denotes |
Hybridizations were carried out overnight. |
T4711 |
19366-19380 |
NNS |
denotes |
Hybridizations |
T4713 |
19381-19385 |
VBD |
denotes |
were |
T4712 |
19386-19393 |
VBN |
denotes |
carried |
T4714 |
19394-19397 |
RP |
denotes |
out |
T4715 |
19398-19407 |
RB |
denotes |
overnight |
T4716 |
19407-19408 |
. |
denotes |
. |
T4717 |
19408-19584 |
sentence |
denotes |
The filters were washed twice with washing buffer I (2×SSC, 0.1% SDS) at 42°C for 15-min, and then washed twice with washing buffer II (0.25×SSC, 0.1% SDS) at 65°C for 15-min. |
T4718 |
19409-19412 |
DT |
denotes |
The |
T4719 |
19413-19420 |
NNS |
denotes |
filters |
T4721 |
19421-19425 |
VBD |
denotes |
were |
T4720 |
19426-19432 |
VBN |
denotes |
washed |
T4722 |
19433-19438 |
RB |
denotes |
twice |
T4723 |
19439-19443 |
IN |
denotes |
with |
T4724 |
19444-19451 |
VBG |
denotes |
washing |
T4725 |
19452-19458 |
NN |
denotes |
buffer |
T4726 |
19459-19460 |
CD |
denotes |
I |
T4727 |
19461-19462 |
-LRB- |
denotes |
( |
T4729 |
19462-19463 |
CD |
denotes |
2 |
T4731 |
19463-19464 |
SYM |
denotes |
× |
T4730 |
19464-19467 |
NN |
denotes |
SSC |
T4732 |
19467-19469 |
, |
denotes |
, |
T4733 |
19469-19472 |
CD |
denotes |
0.1 |
T4734 |
19472-19473 |
NN |
denotes |
% |
T4728 |
19474-19477 |
NN |
denotes |
SDS |
T4735 |
19477-19478 |
-RRB- |
denotes |
) |
T4736 |
19479-19481 |
IN |
denotes |
at |
T4737 |
19482-19484 |
CD |
denotes |
42 |
T4738 |
19484-19486 |
NN |
denotes |
°C |
T4739 |
19487-19490 |
IN |
denotes |
for |
T4740 |
19491-19493 |
CD |
denotes |
15 |
T4742 |
19493-19494 |
HYPH |
denotes |
- |
T4741 |
19494-19497 |
NN |
denotes |
min |
T4743 |
19497-19499 |
, |
denotes |
, |
T4744 |
19499-19502 |
CC |
denotes |
and |
T4745 |
19503-19507 |
RB |
denotes |
then |
T4746 |
19508-19514 |
VBD |
denotes |
washed |
T4747 |
19515-19520 |
RB |
denotes |
twice |
T4748 |
19521-19525 |
IN |
denotes |
with |
T4749 |
19526-19533 |
NN |
denotes |
washing |
T4750 |
19534-19540 |
NN |
denotes |
buffer |
T4751 |
19541-19543 |
CD |
denotes |
II |
T4752 |
19544-19545 |
-LRB- |
denotes |
( |
T4754 |
19545-19549 |
CD |
denotes |
0.25 |
T4756 |
19549-19550 |
SYM |
denotes |
× |
T4755 |
19550-19553 |
NN |
denotes |
SSC |
T4757 |
19553-19555 |
, |
denotes |
, |
T4758 |
19555-19558 |
CD |
denotes |
0.1 |
T4759 |
19558-19559 |
NN |
denotes |
% |
T4753 |
19560-19563 |
NN |
denotes |
SDS |
T4760 |
19563-19564 |
-RRB- |
denotes |
) |
T4761 |
19565-19567 |
IN |
denotes |
at |
T4762 |
19568-19570 |
CD |
denotes |
65 |
T4763 |
19570-19572 |
NN |
denotes |
°C |
T4764 |
19573-19576 |
IN |
denotes |
for |
T4765 |
19577-19579 |
CD |
denotes |
15 |
T4767 |
19579-19580 |
HYPH |
denotes |
- |
T4766 |
19580-19583 |
NN |
denotes |
min |
T4768 |
19583-19584 |
. |
denotes |
. |
T4769 |
19584-19658 |
sentence |
denotes |
Washed filters were exposed to X-ray films for overnight or longer [3,4]. |
T4770 |
19585-19591 |
JJ |
denotes |
Washed |
T4771 |
19592-19599 |
NNS |
denotes |
filters |
T4773 |
19600-19604 |
VBD |
denotes |
were |
T4772 |
19605-19612 |
VBN |
denotes |
exposed |
T4774 |
19613-19615 |
IN |
denotes |
to |
T4775 |
19616-19621 |
NN |
denotes |
X-ray |
T4776 |
19622-19627 |
NNS |
denotes |
films |
T4777 |
19628-19631 |
IN |
denotes |
for |
T4778 |
19632-19641 |
NN |
denotes |
overnight |
T4779 |
19642-19644 |
CC |
denotes |
or |
T4780 |
19645-19651 |
RBR |
denotes |
longer |
T4781 |
19652-19653 |
-LRB- |
denotes |
[ |
T4783 |
19653-19654 |
CD |
denotes |
3 |
T4784 |
19654-19655 |
, |
denotes |
, |
T4782 |
19655-19656 |
CD |
denotes |
4 |
T4785 |
19656-19657 |
-RRB- |
denotes |
] |
T4786 |
19657-19658 |
. |
denotes |
. |
T4823 |
19660-19668 |
NN |
denotes |
Antibody |
T4824 |
19669-19679 |
NN |
denotes |
production |
T4825 |
19680-19683 |
CC |
denotes |
and |
T4826 |
19684-19691 |
NNP |
denotes |
Western |
T4827 |
19692-19696 |
NN |
denotes |
blot |
T4828 |
19697-19705 |
NNS |
denotes |
analyses |
T4829 |
19705-19931 |
sentence |
denotes |
Peptides linked to KLH (keyhole limpet hemacyanin) from Acdp1 N- and C-terminals and the conserved domain (ACD) were used for generation of antibodies specifically for Acdp1 and all Acdp members as reported, respectively [5]. |
T4830 |
19706-19714 |
NNS |
denotes |
Peptides |
T4832 |
19715-19721 |
VBN |
denotes |
linked |
T4833 |
19722-19724 |
IN |
denotes |
to |
T4834 |
19725-19728 |
NN |
denotes |
KLH |
T4835 |
19729-19730 |
-LRB- |
denotes |
( |
T4836 |
19730-19737 |
NN |
denotes |
keyhole |
T4838 |
19738-19744 |
NN |
denotes |
limpet |
T4837 |
19745-19755 |
NN |
denotes |
hemacyanin |
T4839 |
19755-19756 |
-RRB- |
denotes |
) |
T4840 |
19757-19761 |
IN |
denotes |
from |
T4841 |
19762-19767 |
NN |
denotes |
Acdp1 |
T4843 |
19768-19769 |
NN |
denotes |
N |
T4844 |
19769-19770 |
HYPH |
denotes |
- |
T4845 |
19771-19774 |
CC |
denotes |
and |
T4846 |
19775-19776 |
NN |
denotes |
C |
T4847 |
19776-19777 |
HYPH |
denotes |
- |
T4842 |
19777-19786 |
NNS |
denotes |
terminals |
T4848 |
19787-19790 |
CC |
denotes |
and |
T4849 |
19791-19794 |
DT |
denotes |
the |
T4851 |
19795-19804 |
VBN |
denotes |
conserved |
T4850 |
19805-19811 |
NN |
denotes |
domain |
T4852 |
19812-19813 |
-LRB- |
denotes |
( |
T4853 |
19813-19816 |
NN |
denotes |
ACD |
T4854 |
19816-19817 |
-RRB- |
denotes |
) |
T4855 |
19818-19822 |
VBD |
denotes |
were |
T4831 |
19823-19827 |
VBN |
denotes |
used |
T4856 |
19828-19831 |
IN |
denotes |
for |
T4857 |
19832-19842 |
NN |
denotes |
generation |
T4858 |
19843-19845 |
IN |
denotes |
of |
T4859 |
19846-19856 |
NNS |
denotes |
antibodies |
T4860 |
19857-19869 |
RB |
denotes |
specifically |
T4861 |
19870-19873 |
IN |
denotes |
for |
T4862 |
19874-19879 |
NN |
denotes |
Acdp1 |
T4863 |
19880-19883 |
CC |
denotes |
and |
T4864 |
19884-19887 |
DT |
denotes |
all |
T4866 |
19888-19892 |
NN |
denotes |
Acdp |
T4865 |
19893-19900 |
NNS |
denotes |
members |
T4867 |
19901-19903 |
IN |
denotes |
as |
T4868 |
19904-19912 |
VBN |
denotes |
reported |
T4869 |
19912-19914 |
, |
denotes |
, |
T4870 |
19914-19926 |
RB |
denotes |
respectively |
T4871 |
19927-19928 |
-LRB- |
denotes |
[ |
T4872 |
19928-19929 |
CD |
denotes |
5 |
T4873 |
19929-19930 |
-RRB- |
denotes |
] |
T4874 |
19930-19931 |
. |
denotes |
. |
T4875 |
19931-20010 |
sentence |
denotes |
Western blots were carried out Using ECL (PIERCE) as described previously [1]. |
T4876 |
19932-19939 |
NNP |
denotes |
Western |
T4877 |
19940-19945 |
NNS |
denotes |
blots |
T4879 |
19946-19950 |
VBD |
denotes |
were |
T4878 |
19951-19958 |
VBN |
denotes |
carried |
T4880 |
19959-19962 |
RP |
denotes |
out |
T4881 |
19963-19968 |
VBG |
denotes |
Using |
T4882 |
19969-19972 |
NN |
denotes |
ECL |
T4883 |
19973-19974 |
-LRB- |
denotes |
( |
T4884 |
19974-19980 |
NN |
denotes |
PIERCE |
T4885 |
19980-19981 |
-RRB- |
denotes |
) |
T4886 |
19982-19984 |
IN |
denotes |
as |
T4887 |
19985-19994 |
VBN |
denotes |
described |
T4888 |
19995-20005 |
RB |
denotes |
previously |
T4889 |
20006-20007 |
-LRB- |
denotes |
[ |
T4890 |
20007-20008 |
CD |
denotes |
1 |
T4891 |
20008-20009 |
-RRB- |
denotes |
] |
T4892 |
20009-20010 |
. |
denotes |
. |
T4893 |
20010-20172 |
sentence |
denotes |
The membranes were washed extensively after incubation with primary and secondary antibodies and were then developed with X-ray films with optimal exposure time. |
T4894 |
20011-20014 |
DT |
denotes |
The |
T4895 |
20015-20024 |
NNS |
denotes |
membranes |
T4897 |
20025-20029 |
VBD |
denotes |
were |
T4896 |
20030-20036 |
VBN |
denotes |
washed |
T4898 |
20037-20048 |
RB |
denotes |
extensively |
T4899 |
20049-20054 |
IN |
denotes |
after |
T4900 |
20055-20065 |
NN |
denotes |
incubation |
T4901 |
20066-20070 |
IN |
denotes |
with |
T4902 |
20071-20078 |
JJ |
denotes |
primary |
T4904 |
20079-20082 |
CC |
denotes |
and |
T4905 |
20083-20092 |
JJ |
denotes |
secondary |
T4903 |
20093-20103 |
NNS |
denotes |
antibodies |
T4906 |
20104-20107 |
CC |
denotes |
and |
T4907 |
20108-20112 |
VBD |
denotes |
were |
T4909 |
20113-20117 |
RB |
denotes |
then |
T4908 |
20118-20127 |
VBN |
denotes |
developed |
T4910 |
20128-20132 |
IN |
denotes |
with |
T4911 |
20133-20138 |
NN |
denotes |
X-ray |
T4912 |
20139-20144 |
NNS |
denotes |
films |
T4913 |
20145-20149 |
IN |
denotes |
with |
T4914 |
20150-20157 |
JJ |
denotes |
optimal |
T4916 |
20158-20166 |
NN |
denotes |
exposure |
T4915 |
20167-20171 |
NN |
denotes |
time |
T4917 |
20171-20172 |
. |
denotes |
. |
T4941 |
20174-20184 |
NN |
denotes |
Chromosome |
T4942 |
20185-20197 |
NN |
denotes |
localization |
T4943 |
20197-20318 |
sentence |
denotes |
The T31 mouse radiation hybrid panel from Research Genetics was used to map the chromosome location of each Acdp member. |
T4944 |
20198-20201 |
DT |
denotes |
The |
T4946 |
20202-20205 |
NN |
denotes |
T31 |
T4947 |
20206-20211 |
NN |
denotes |
mouse |
T4948 |
20212-20221 |
NN |
denotes |
radiation |
T4949 |
20222-20228 |
NN |
denotes |
hybrid |
T4945 |
20229-20234 |
NN |
denotes |
panel |
T4951 |
20235-20239 |
IN |
denotes |
from |
T4952 |
20240-20248 |
NNP |
denotes |
Research |
T4953 |
20249-20257 |
NNP |
denotes |
Genetics |
T4954 |
20258-20261 |
VBD |
denotes |
was |
T4950 |
20262-20266 |
VBN |
denotes |
used |
T4955 |
20267-20269 |
TO |
denotes |
to |
T4956 |
20270-20273 |
VB |
denotes |
map |
T4957 |
20274-20277 |
DT |
denotes |
the |
T4959 |
20278-20288 |
NN |
denotes |
chromosome |
T4958 |
20289-20297 |
NN |
denotes |
location |
T4960 |
20298-20300 |
IN |
denotes |
of |
T4961 |
20301-20305 |
DT |
denotes |
each |
T4963 |
20306-20310 |
NN |
denotes |
Acdp |
T4962 |
20311-20317 |
NN |
denotes |
member |
T4964 |
20317-20318 |
. |
denotes |
. |
T4965 |
20318-20442 |
sentence |
denotes |
Primers from 3' UTR of each Acdp member were used to amplify the 100 radiation hybrid clones representing the mouse genome. |
T4966 |
20319-20326 |
NNS |
denotes |
Primers |
T4968 |
20327-20331 |
IN |
denotes |
from |
T4969 |
20332-20333 |
CD |
denotes |
3 |
T4971 |
20333-20334 |
SYM |
denotes |
' |
T4970 |
20335-20338 |
NN |
denotes |
UTR |
T4972 |
20339-20341 |
IN |
denotes |
of |
T4973 |
20342-20346 |
DT |
denotes |
each |
T4975 |
20347-20351 |
NN |
denotes |
Acdp |
T4974 |
20352-20358 |
NN |
denotes |
member |
T4976 |
20359-20363 |
VBD |
denotes |
were |
T4967 |
20364-20368 |
VBN |
denotes |
used |
T4977 |
20369-20371 |
TO |
denotes |
to |
T4978 |
20372-20379 |
VB |
denotes |
amplify |
T4979 |
20380-20383 |
DT |
denotes |
the |
T4981 |
20384-20387 |
CD |
denotes |
100 |
T4982 |
20388-20397 |
NN |
denotes |
radiation |
T4983 |
20398-20404 |
JJ |
denotes |
hybrid |
T4980 |
20405-20411 |
NNS |
denotes |
clones |
T4984 |
20412-20424 |
VBG |
denotes |
representing |
T4985 |
20425-20428 |
DT |
denotes |
the |
T4987 |
20429-20434 |
NN |
denotes |
mouse |
T4986 |
20435-20441 |
NN |
denotes |
genome |
T4988 |
20441-20442 |
. |
denotes |
. |
T4989 |
20442-20538 |
sentence |
denotes |
The data were submitted to the Jackson Laboratory Mouse Radiation Hybrid Database for analysis. |
T4990 |
20443-20446 |
DT |
denotes |
The |
T4991 |
20447-20451 |
NNS |
denotes |
data |
T4993 |
20452-20456 |
VBD |
denotes |
were |
T4992 |
20457-20466 |
VBN |
denotes |
submitted |
T4994 |
20467-20469 |
IN |
denotes |
to |
T4995 |
20470-20473 |
DT |
denotes |
the |
T4997 |
20474-20481 |
NNP |
denotes |
Jackson |
T4998 |
20482-20492 |
NNP |
denotes |
Laboratory |
T4999 |
20493-20498 |
NNP |
denotes |
Mouse |
T5001 |
20499-20508 |
NNP |
denotes |
Radiation |
T5000 |
20509-20515 |
NNP |
denotes |
Hybrid |
T4996 |
20516-20524 |
NNP |
denotes |
Database |
T5002 |
20525-20528 |
IN |
denotes |
for |
T5003 |
20529-20537 |
NN |
denotes |
analysis |
T5004 |
20537-20538 |
. |
denotes |
. |
T5023 |
20540-20548 |
NN |
denotes |
Sequence |
T5024 |
20549-20557 |
NNS |
denotes |
analyses |
T5025 |
20557-20632 |
sentence |
denotes |
Sequence assembly was performed with program Sequencher (Gene Codes Corp). |
T5026 |
20558-20566 |
NN |
denotes |
Sequence |
T5027 |
20567-20575 |
NN |
denotes |
assembly |
T5029 |
20576-20579 |
VBD |
denotes |
was |
T5028 |
20580-20589 |
VBN |
denotes |
performed |
T5030 |
20590-20594 |
IN |
denotes |
with |
T5031 |
20595-20602 |
NN |
denotes |
program |
T5032 |
20603-20613 |
NN |
denotes |
Sequencher |
T5033 |
20614-20615 |
-LRB- |
denotes |
( |
T5035 |
20615-20619 |
NNP |
denotes |
Gene |
T5036 |
20620-20625 |
NNPS |
denotes |
Codes |
T5034 |
20626-20630 |
NNP |
denotes |
Corp |
T5037 |
20630-20631 |
-RRB- |
denotes |
) |
T5038 |
20631-20632 |
. |
denotes |
. |
T5039 |
20632-20735 |
sentence |
denotes |
Protein and DNA homology searches were carried out with tblastn, tblastx, blastp and blastn programs . |
T5040 |
20633-20640 |
NN |
denotes |
Protein |
T5042 |
20641-20644 |
CC |
denotes |
and |
T5043 |
20645-20648 |
NN |
denotes |
DNA |
T5041 |
20649-20657 |
NN |
denotes |
homology |
T5044 |
20658-20666 |
NNS |
denotes |
searches |
T5046 |
20667-20671 |
VBD |
denotes |
were |
T5045 |
20672-20679 |
VBN |
denotes |
carried |
T5047 |
20680-20683 |
RP |
denotes |
out |
T5048 |
20684-20688 |
IN |
denotes |
with |
T5049 |
20689-20696 |
NN |
denotes |
tblastn |
T5051 |
20696-20698 |
, |
denotes |
, |
T5052 |
20698-20705 |
NN |
denotes |
tblastx |
T5053 |
20705-20707 |
, |
denotes |
, |
T5054 |
20707-20713 |
NN |
denotes |
blastp |
T5055 |
20714-20717 |
CC |
denotes |
and |
T5056 |
20718-20724 |
NN |
denotes |
blastn |
T5050 |
20725-20733 |
NNS |
denotes |
programs |
T5057 |
20734-20735 |
. |
denotes |
. |
T5058 |
20735-20826 |
sentence |
denotes |
Multiple sequence alignments were performed with GeneDoc and pairwise sequence alignment . |
T5059 |
20736-20744 |
JJ |
denotes |
Multiple |
T5061 |
20745-20753 |
NN |
denotes |
sequence |
T5060 |
20754-20764 |
NNS |
denotes |
alignments |
T5063 |
20765-20769 |
VBD |
denotes |
were |
T5062 |
20770-20779 |
VBN |
denotes |
performed |
T5064 |
20780-20784 |
IN |
denotes |
with |
T5065 |
20785-20792 |
NN |
denotes |
GeneDoc |
T5067 |
20793-20796 |
CC |
denotes |
and |
T5068 |
20797-20805 |
JJ |
denotes |
pairwise |
T5069 |
20806-20814 |
NN |
denotes |
sequence |
T5066 |
20815-20824 |
NN |
denotes |
alignment |
T5070 |
20825-20826 |
. |
denotes |
. |
T5071 |
20826-20994 |
sentence |
denotes |
Multiple programs including BCM Search Launcher , ProfileScan , sequence motif search , ExPASy and 3Dpssm were used for searching sequence features of known protein. |
T5072 |
20827-20835 |
JJ |
denotes |
Multiple |
T5073 |
20836-20844 |
NNS |
denotes |
programs |
T5075 |
20845-20854 |
VBG |
denotes |
including |
T5076 |
20855-20858 |
NN |
denotes |
BCM |
T5078 |
20859-20865 |
NN |
denotes |
Search |
T5077 |
20866-20874 |
NN |
denotes |
Launcher |
T5079 |
20875-20877 |
, |
denotes |
, |
T5080 |
20877-20888 |
NN |
denotes |
ProfileScan |
T5081 |
20889-20891 |
, |
denotes |
, |
T5082 |
20891-20899 |
NN |
denotes |
sequence |
T5084 |
20900-20905 |
NN |
denotes |
motif |
T5083 |
20906-20912 |
NN |
denotes |
search |
T5085 |
20913-20915 |
, |
denotes |
, |
T5086 |
20915-20921 |
NN |
denotes |
ExPASy |
T5087 |
20923-20926 |
CC |
denotes |
and |
T5088 |
20927-20933 |
NN |
denotes |
3Dpssm |
T5089 |
20935-20939 |
VBD |
denotes |
were |
T5074 |
20940-20944 |
VBN |
denotes |
used |
T5090 |
20945-20948 |
IN |
denotes |
for |
T5091 |
20949-20958 |
VBG |
denotes |
searching |
T5092 |
20959-20967 |
NN |
denotes |
sequence |
T5093 |
20968-20976 |
NNS |
denotes |
features |
T5094 |
20977-20979 |
IN |
denotes |
of |
T5095 |
20980-20985 |
JJ |
denotes |
known |
T5096 |
20986-20993 |
NN |
denotes |
protein |
T5097 |
20993-20994 |
. |
denotes |
. |
T5098 |
20994-21148 |
sentence |
denotes |
Phylogenetic tree was constructed by Clustalw program (version 1.81) using UPGMA (Unweighted Pair Group Method using Arithmetic averages) algorithm [14]. |
T5099 |
20995-21007 |
JJ |
denotes |
Phylogenetic |
T5100 |
21008-21012 |
NN |
denotes |
tree |
T5102 |
21013-21016 |
VBD |
denotes |
was |
T5101 |
21017-21028 |
VBN |
denotes |
constructed |
T5103 |
21029-21031 |
IN |
denotes |
by |
T5104 |
21032-21040 |
NN |
denotes |
Clustalw |
T5105 |
21041-21048 |
NN |
denotes |
program |
T5106 |
21049-21050 |
-LRB- |
denotes |
( |
T5107 |
21050-21057 |
NN |
denotes |
version |
T5108 |
21058-21062 |
CD |
denotes |
1.81 |
T5109 |
21062-21063 |
-RRB- |
denotes |
) |
T5110 |
21064-21069 |
VBG |
denotes |
using |
T5111 |
21070-21075 |
NN |
denotes |
UPGMA |
T5113 |
21076-21077 |
-LRB- |
denotes |
( |
T5114 |
21077-21087 |
JJ |
denotes |
Unweighted |
T5116 |
21088-21092 |
NN |
denotes |
Pair |
T5117 |
21093-21098 |
NN |
denotes |
Group |
T5115 |
21099-21105 |
NN |
denotes |
Method |
T5118 |
21106-21111 |
VBG |
denotes |
using |
T5119 |
21112-21122 |
NN |
denotes |
Arithmetic |
T5120 |
21123-21131 |
NNS |
denotes |
averages |
T5121 |
21131-21132 |
-RRB- |
denotes |
) |
T5112 |
21133-21142 |
NN |
denotes |
algorithm |
T5122 |
21143-21144 |
-LRB- |
denotes |
[ |
T5123 |
21144-21146 |
CD |
denotes |
14 |
T5124 |
21146-21147 |
-RRB- |
denotes |
] |
T5125 |
21147-21148 |
. |
denotes |
. |
T5264 |
21150-21158 |
JJ |
denotes |
Neuronal |
T5266 |
21159-21163 |
NN |
denotes |
cell |
T5265 |
21164-21175 |
NN |
denotes |
preparation |
T5267 |
21176-21179 |
CC |
denotes |
and |
T5268 |
21180-21195 |
NN |
denotes |
immunostanining |
T5269 |
21195-21265 |
sentence |
denotes |
Hippocampal neuron cultures were prepared as previously reported [6]. |
T5270 |
21196-21207 |
JJ |
denotes |
Hippocampal |
T5272 |
21208-21214 |
NN |
denotes |
neuron |
T5271 |
21215-21223 |
NNS |
denotes |
cultures |
T5274 |
21224-21228 |
VBD |
denotes |
were |
T5273 |
21229-21237 |
VBN |
denotes |
prepared |
T5275 |
21238-21240 |
IN |
denotes |
as |
T5277 |
21241-21251 |
RB |
denotes |
previously |
T5276 |
21252-21260 |
VBN |
denotes |
reported |
T5278 |
21261-21262 |
-LRB- |
denotes |
[ |
T5279 |
21262-21263 |
CD |
denotes |
6 |
T5280 |
21263-21264 |
-RRB- |
denotes |
] |
T5281 |
21264-21265 |
. |
denotes |
. |
T5282 |
21265-21352 |
sentence |
denotes |
In brief, the hippocampuses were dissected out from mouse embryos at 16 days in utero. |
T5283 |
21266-21268 |
IN |
denotes |
In |
T5285 |
21269-21274 |
NN |
denotes |
brief |
T5286 |
21274-21276 |
, |
denotes |
, |
T5287 |
21276-21279 |
DT |
denotes |
the |
T5288 |
21280-21293 |
NNS |
denotes |
hippocampuses |
T5289 |
21294-21298 |
VBD |
denotes |
were |
T5284 |
21299-21308 |
VBN |
denotes |
dissected |
T5290 |
21309-21312 |
RP |
denotes |
out |
T5291 |
21313-21317 |
IN |
denotes |
from |
T5292 |
21318-21323 |
NN |
denotes |
mouse |
T5293 |
21324-21331 |
NNS |
denotes |
embryos |
T5294 |
21332-21334 |
IN |
denotes |
at |
T5295 |
21335-21337 |
CD |
denotes |
16 |
T5296 |
21338-21342 |
NNS |
denotes |
days |
T5297 |
21343-21345 |
FW |
denotes |
in |
T5298 |
21346-21351 |
FW |
denotes |
utero |
T5299 |
21351-21352 |
. |
denotes |
. |
T5300 |
21352-21529 |
sentence |
denotes |
The tissues were then incubated for 20 min at 37°C in MEM (minimum essential medium) modified for suspension culture (Life Technologies) plus 0.25% trypsin (Life Technologies). |
T5301 |
21353-21356 |
DT |
denotes |
The |
T5302 |
21357-21364 |
NNS |
denotes |
tissues |
T5304 |
21365-21369 |
VBD |
denotes |
were |
T5305 |
21370-21374 |
RB |
denotes |
then |
T5303 |
21375-21384 |
VBN |
denotes |
incubated |
T5306 |
21385-21388 |
IN |
denotes |
for |
T5307 |
21389-21391 |
CD |
denotes |
20 |
T5308 |
21392-21395 |
NN |
denotes |
min |
T5309 |
21396-21398 |
IN |
denotes |
at |
T5310 |
21399-21401 |
CD |
denotes |
37 |
T5311 |
21401-21403 |
NN |
denotes |
°C |
T5312 |
21404-21406 |
IN |
denotes |
in |
T5313 |
21407-21410 |
NN |
denotes |
MEM |
T5314 |
21411-21412 |
-LRB- |
denotes |
( |
T5315 |
21412-21419 |
JJ |
denotes |
minimum |
T5317 |
21420-21429 |
JJ |
denotes |
essential |
T5316 |
21430-21436 |
NN |
denotes |
medium |
T5318 |
21436-21437 |
-RRB- |
denotes |
) |
T5319 |
21438-21446 |
VBN |
denotes |
modified |
T5320 |
21447-21450 |
IN |
denotes |
for |
T5321 |
21451-21461 |
NN |
denotes |
suspension |
T5322 |
21462-21469 |
NN |
denotes |
culture |
T5323 |
21470-21471 |
-LRB- |
denotes |
( |
T5325 |
21471-21475 |
NNP |
denotes |
Life |
T5324 |
21476-21488 |
NNP |
denotes |
Technologies |
T5326 |
21488-21489 |
-RRB- |
denotes |
) |
T5327 |
21490-21494 |
CC |
denotes |
plus |
T5328 |
21495-21499 |
CD |
denotes |
0.25 |
T5329 |
21499-21500 |
NN |
denotes |
% |
T5330 |
21501-21508 |
NN |
denotes |
trypsin |
T5331 |
21509-21510 |
-LRB- |
denotes |
( |
T5333 |
21510-21514 |
NNP |
denotes |
Life |
T5332 |
21515-21527 |
NNP |
denotes |
Technologies |
T5334 |
21527-21528 |
-RRB- |
denotes |
) |
T5335 |
21528-21529 |
. |
denotes |
. |
T5336 |
21529-21689 |
sentence |
denotes |
The dissociated hippocampal neurons were plated on glass coverslips coated with a confluent monolayer of mouse cortical astrocytes obtained as described below. |
T5337 |
21530-21533 |
DT |
denotes |
The |
T5339 |
21534-21545 |
JJ |
denotes |
dissociated |
T5340 |
21546-21557 |
JJ |
denotes |
hippocampal |
T5338 |
21558-21565 |
NNS |
denotes |
neurons |
T5342 |
21566-21570 |
VBD |
denotes |
were |
T5341 |
21571-21577 |
VBN |
denotes |
plated |
T5343 |
21578-21580 |
IN |
denotes |
on |
T5344 |
21581-21586 |
NN |
denotes |
glass |
T5345 |
21587-21597 |
NNS |
denotes |
coverslips |
T5346 |
21598-21604 |
VBN |
denotes |
coated |
T5347 |
21605-21609 |
IN |
denotes |
with |
T5348 |
21610-21611 |
DT |
denotes |
a |
T5350 |
21612-21621 |
JJ |
denotes |
confluent |
T5349 |
21622-21631 |
NN |
denotes |
monolayer |
T5351 |
21632-21634 |
IN |
denotes |
of |
T5352 |
21635-21640 |
NN |
denotes |
mouse |
T5354 |
21641-21649 |
JJ |
denotes |
cortical |
T5353 |
21650-21660 |
NNS |
denotes |
astrocytes |
T5355 |
21661-21669 |
VBN |
denotes |
obtained |
T5356 |
21670-21672 |
IN |
denotes |
as |
T5357 |
21673-21682 |
VBN |
denotes |
described |
T5358 |
21683-21688 |
RB |
denotes |
below |
T5359 |
21688-21689 |
. |
denotes |
. |
T5360 |
21689-21765 |
sentence |
denotes |
The neurons were maintained at 37°C in a humidified atmosphere with 5% CO2. |
T5361 |
21690-21693 |
DT |
denotes |
The |
T5362 |
21694-21701 |
NNS |
denotes |
neurons |
T5364 |
21702-21706 |
VBD |
denotes |
were |
T5363 |
21707-21717 |
VBN |
denotes |
maintained |
T5365 |
21718-21720 |
IN |
denotes |
at |
T5366 |
21721-21723 |
CD |
denotes |
37 |
T5367 |
21723-21725 |
NN |
denotes |
°C |
T5368 |
21726-21728 |
IN |
denotes |
in |
T5369 |
21729-21730 |
DT |
denotes |
a |
T5371 |
21731-21741 |
JJ |
denotes |
humidified |
T5370 |
21742-21752 |
NN |
denotes |
atmosphere |
T5372 |
21753-21757 |
IN |
denotes |
with |
T5373 |
21758-21759 |
CD |
denotes |
5 |
T5374 |
21759-21760 |
NN |
denotes |
% |
T5375 |
21761-21764 |
NN |
denotes |
CO2 |
T5376 |
21764-21765 |
. |
denotes |
. |
T5377 |
21765-21918 |
sentence |
denotes |
Cortical astrocytes dissociated from newborn mouse cortices were grown in culture flasks at 37°C in a humidified atmosphere with 5% CO2 until confluent. |
T5378 |
21766-21774 |
JJ |
denotes |
Cortical |
T5379 |
21775-21785 |
NNS |
denotes |
astrocytes |
T5381 |
21786-21797 |
VBN |
denotes |
dissociated |
T5382 |
21798-21802 |
IN |
denotes |
from |
T5383 |
21803-21810 |
JJ |
denotes |
newborn |
T5384 |
21811-21816 |
NN |
denotes |
mouse |
T5385 |
21817-21825 |
NNS |
denotes |
cortices |
T5386 |
21826-21830 |
VBD |
denotes |
were |
T5380 |
21831-21836 |
VBN |
denotes |
grown |
T5387 |
21837-21839 |
IN |
denotes |
in |
T5388 |
21840-21847 |
NN |
denotes |
culture |
T5389 |
21848-21854 |
NNS |
denotes |
flasks |
T5390 |
21855-21857 |
IN |
denotes |
at |
T5391 |
21858-21860 |
CD |
denotes |
37 |
T5392 |
21860-21862 |
NN |
denotes |
°C |
T5393 |
21863-21865 |
IN |
denotes |
in |
T5394 |
21866-21867 |
DT |
denotes |
a |
T5396 |
21868-21878 |
JJ |
denotes |
humidified |
T5395 |
21879-21889 |
NN |
denotes |
atmosphere |
T5397 |
21890-21894 |
IN |
denotes |
with |
T5398 |
21895-21896 |
CD |
denotes |
5 |
T5399 |
21896-21897 |
NN |
denotes |
% |
T5400 |
21898-21901 |
NN |
denotes |
CO2 |
T5401 |
21902-21907 |
IN |
denotes |
until |
T5402 |
21908-21917 |
JJ |
denotes |
confluent |
T5403 |
21917-21918 |
. |
denotes |
. |
T5404 |
21918-22027 |
sentence |
denotes |
The cells were exposed to 10-5 M cytosine arabinoside (Sigma) and cultured for additional 12–24 hrs at 37°C. |
T5405 |
21919-21922 |
DT |
denotes |
The |
T5406 |
21923-21928 |
NNS |
denotes |
cells |
T5408 |
21929-21933 |
VBD |
denotes |
were |
T5407 |
21934-21941 |
VBN |
denotes |
exposed |
T5409 |
21942-21944 |
IN |
denotes |
to |
T5410 |
21945-21947 |
CD |
denotes |
10 |
T5412 |
21947-21948 |
SYM |
denotes |
- |
T5411 |
21948-21949 |
CD |
denotes |
5 |
T5413 |
21950-21951 |
NN |
denotes |
M |
T5415 |
21952-21960 |
NN |
denotes |
cytosine |
T5414 |
21961-21972 |
NN |
denotes |
arabinoside |
T5416 |
21973-21974 |
-LRB- |
denotes |
( |
T5417 |
21974-21979 |
NNP |
denotes |
Sigma |
T5418 |
21979-21980 |
-RRB- |
denotes |
) |
T5419 |
21981-21984 |
CC |
denotes |
and |
T5420 |
21985-21993 |
VBN |
denotes |
cultured |
T5421 |
21994-21997 |
IN |
denotes |
for |
T5422 |
21998-22008 |
JJ |
denotes |
additional |
T5424 |
22009-22011 |
CD |
denotes |
12 |
T5426 |
22011-22012 |
SYM |
denotes |
– |
T5425 |
22012-22014 |
CD |
denotes |
24 |
T5423 |
22015-22018 |
NNS |
denotes |
hrs |
T5427 |
22019-22021 |
IN |
denotes |
at |
T5428 |
22022-22024 |
CD |
denotes |
37 |
T5429 |
22024-22026 |
NN |
denotes |
°C |
T5430 |
22026-22027 |
. |
denotes |
. |
T5431 |
22027-22119 |
sentence |
denotes |
After remove of the media with cellular debris, the cells were used for coating coverslips. |
T5432 |
22028-22033 |
IN |
denotes |
After |
T5434 |
22034-22040 |
NN |
denotes |
remove |
T5435 |
22041-22043 |
IN |
denotes |
of |
T5436 |
22044-22047 |
DT |
denotes |
the |
T5437 |
22048-22053 |
NNS |
denotes |
media |
T5438 |
22054-22058 |
IN |
denotes |
with |
T5439 |
22059-22067 |
JJ |
denotes |
cellular |
T5440 |
22068-22074 |
NN |
denotes |
debris |
T5441 |
22074-22076 |
, |
denotes |
, |
T5442 |
22076-22079 |
DT |
denotes |
the |
T5443 |
22080-22085 |
NNS |
denotes |
cells |
T5444 |
22086-22090 |
VBD |
denotes |
were |
T5433 |
22091-22095 |
VBN |
denotes |
used |
T5445 |
22096-22099 |
IN |
denotes |
for |
T5446 |
22100-22107 |
VBG |
denotes |
coating |
T5447 |
22108-22118 |
NNS |
denotes |
coverslips |
T5448 |
22118-22119 |
. |
denotes |
. |
T5449 |
22119-22341 |
sentence |
denotes |
For immunostaining, neuronal cells on the coverslips were first fixed in PBS containing 4% paraformaldehyde (PFA) for 12 hrs at 4°C and then incubated in a solution containing 4% PFA and 0.4% Triton X-100 at 4°C for 1 hr. |
T5450 |
22120-22123 |
IN |
denotes |
For |
T5452 |
22124-22138 |
NN |
denotes |
immunostaining |
T5453 |
22138-22140 |
, |
denotes |
, |
T5454 |
22140-22148 |
JJ |
denotes |
neuronal |
T5455 |
22149-22154 |
NNS |
denotes |
cells |
T5456 |
22155-22157 |
IN |
denotes |
on |
T5457 |
22158-22161 |
DT |
denotes |
the |
T5458 |
22162-22172 |
NNS |
denotes |
coverslips |
T5459 |
22173-22177 |
VBD |
denotes |
were |
T5460 |
22178-22183 |
RB |
denotes |
first |
T5451 |
22184-22189 |
VBN |
denotes |
fixed |
T5461 |
22190-22192 |
IN |
denotes |
in |
T5462 |
22193-22196 |
NN |
denotes |
PBS |
T5463 |
22197-22207 |
VBG |
denotes |
containing |
T5464 |
22208-22209 |
CD |
denotes |
4 |
T5465 |
22209-22210 |
NN |
denotes |
% |
T5466 |
22211-22227 |
NN |
denotes |
paraformaldehyde |
T5467 |
22228-22229 |
-LRB- |
denotes |
( |
T5468 |
22229-22232 |
NN |
denotes |
PFA |
T5469 |
22232-22233 |
-RRB- |
denotes |
) |
T5470 |
22234-22237 |
IN |
denotes |
for |
T5471 |
22238-22240 |
CD |
denotes |
12 |
T5472 |
22241-22244 |
NNS |
denotes |
hrs |
T5473 |
22245-22247 |
IN |
denotes |
at |
T5474 |
22248-22249 |
CD |
denotes |
4 |
T5475 |
22249-22251 |
NN |
denotes |
°C |
T5476 |
22252-22255 |
CC |
denotes |
and |
T5477 |
22256-22260 |
RB |
denotes |
then |
T5478 |
22261-22270 |
VBN |
denotes |
incubated |
T5479 |
22271-22273 |
IN |
denotes |
in |
T5480 |
22274-22275 |
DT |
denotes |
a |
T5481 |
22276-22284 |
NN |
denotes |
solution |
T5482 |
22285-22295 |
VBG |
denotes |
containing |
T5483 |
22296-22297 |
CD |
denotes |
4 |
T5484 |
22297-22298 |
NN |
denotes |
% |
T5485 |
22299-22302 |
NN |
denotes |
PFA |
T5486 |
22303-22306 |
CC |
denotes |
and |
T5487 |
22307-22310 |
CD |
denotes |
0.4 |
T5488 |
22310-22311 |
NN |
denotes |
% |
T5490 |
22312-22318 |
NN |
denotes |
Triton |
T5491 |
22319-22320 |
NN |
denotes |
X |
T5492 |
22320-22321 |
HYPH |
denotes |
- |
T5489 |
22321-22324 |
NN |
denotes |
100 |
T5493 |
22325-22327 |
IN |
denotes |
at |
T5494 |
22328-22329 |
CD |
denotes |
4 |
T5495 |
22329-22331 |
NN |
denotes |
°C |
T5496 |
22332-22335 |
IN |
denotes |
for |
T5497 |
22336-22337 |
CD |
denotes |
1 |
T5498 |
22338-22340 |
NN |
denotes |
hr |
T5499 |
22340-22341 |
. |
denotes |
. |
T5500 |
22341-22560 |
sentence |
denotes |
After washing with PBS three times, the cells were incubated with a blocking solution containing 1:30 normal goat serum, and subsequently incubated with a rabbit polyclonal anti-ACDP antibody (1:3000) overnight at 4°C. |
T5501 |
22342-22347 |
IN |
denotes |
After |
T5503 |
22348-22355 |
VBG |
denotes |
washing |
T5504 |
22356-22360 |
IN |
denotes |
with |
T5505 |
22361-22364 |
NN |
denotes |
PBS |
T5506 |
22365-22370 |
CD |
denotes |
three |
T5507 |
22371-22376 |
NNS |
denotes |
times |
T5508 |
22376-22378 |
, |
denotes |
, |
T5509 |
22378-22381 |
DT |
denotes |
the |
T5510 |
22382-22387 |
NNS |
denotes |
cells |
T5511 |
22388-22392 |
VBD |
denotes |
were |
T5502 |
22393-22402 |
VBN |
denotes |
incubated |
T5512 |
22403-22407 |
IN |
denotes |
with |
T5513 |
22408-22409 |
DT |
denotes |
a |
T5515 |
22410-22418 |
VBG |
denotes |
blocking |
T5514 |
22419-22427 |
NN |
denotes |
solution |
T5516 |
22428-22438 |
VBG |
denotes |
containing |
T5517 |
22439-22440 |
CD |
denotes |
1 |
T5519 |
22440-22441 |
SYM |
denotes |
: |
T5520 |
22441-22443 |
CD |
denotes |
30 |
T5521 |
22444-22450 |
JJ |
denotes |
normal |
T5522 |
22451-22455 |
NN |
denotes |
goat |
T5518 |
22456-22461 |
NN |
denotes |
serum |
T5523 |
22461-22463 |
, |
denotes |
, |
T5524 |
22463-22466 |
CC |
denotes |
and |
T5525 |
22467-22479 |
RB |
denotes |
subsequently |
T5526 |
22480-22489 |
VBN |
denotes |
incubated |
T5527 |
22490-22494 |
IN |
denotes |
with |
T5528 |
22495-22496 |
DT |
denotes |
a |
T5530 |
22497-22503 |
NN |
denotes |
rabbit |
T5531 |
22504-22514 |
JJ |
denotes |
polyclonal |
T5532 |
22515-22524 |
JJ |
denotes |
anti-ACDP |
T5529 |
22525-22533 |
NN |
denotes |
antibody |
T5533 |
22534-22535 |
-LRB- |
denotes |
( |
T5534 |
22535-22536 |
CD |
denotes |
1 |
T5535 |
22536-22537 |
SYM |
denotes |
: |
T5536 |
22537-22541 |
CD |
denotes |
3000 |
T5537 |
22541-22542 |
-RRB- |
denotes |
) |
T5538 |
22543-22552 |
RB |
denotes |
overnight |
T5539 |
22553-22555 |
IN |
denotes |
at |
T5540 |
22556-22557 |
CD |
denotes |
4 |
T5541 |
22557-22559 |
NN |
denotes |
°C |
T5542 |
22559-22560 |
. |
denotes |
. |
T5543 |
22560-22776 |
sentence |
denotes |
After extensive washing with 1% goat serum PBS solution, the cells were incubated with an Alex 488 conjugated secondary antibody (1:100 in 1% goat serum PBS solution, Molecular Probes) for 3 hrs at room temperature. |
T5544 |
22561-22566 |
IN |
denotes |
After |
T5546 |
22567-22576 |
JJ |
denotes |
extensive |
T5547 |
22577-22584 |
NN |
denotes |
washing |
T5548 |
22585-22589 |
IN |
denotes |
with |
T5549 |
22590-22591 |
CD |
denotes |
1 |
T5550 |
22591-22592 |
NN |
denotes |
% |
T5552 |
22593-22597 |
NN |
denotes |
goat |
T5551 |
22598-22603 |
NN |
denotes |
serum |
T5554 |
22604-22607 |
NN |
denotes |
PBS |
T5553 |
22608-22616 |
NN |
denotes |
solution |
T5555 |
22616-22618 |
, |
denotes |
, |
T5556 |
22618-22621 |
DT |
denotes |
the |
T5557 |
22622-22627 |
NNS |
denotes |
cells |
T5558 |
22628-22632 |
VBD |
denotes |
were |
T5545 |
22633-22642 |
VBN |
denotes |
incubated |
T5559 |
22643-22647 |
IN |
denotes |
with |
T5560 |
22648-22650 |
DT |
denotes |
an |
T5562 |
22651-22655 |
NNP |
denotes |
Alex |
T5563 |
22656-22659 |
CD |
denotes |
488 |
T5564 |
22660-22670 |
JJ |
denotes |
conjugated |
T5565 |
22671-22680 |
JJ |
denotes |
secondary |
T5561 |
22681-22689 |
NN |
denotes |
antibody |
T5566 |
22690-22691 |
-LRB- |
denotes |
( |
T5568 |
22691-22692 |
CD |
denotes |
1 |
T5569 |
22692-22693 |
SYM |
denotes |
: |
T5570 |
22693-22696 |
CD |
denotes |
100 |
T5571 |
22697-22699 |
IN |
denotes |
in |
T5572 |
22700-22701 |
CD |
denotes |
1 |
T5573 |
22701-22702 |
NN |
denotes |
% |
T5575 |
22703-22707 |
NN |
denotes |
goat |
T5574 |
22708-22713 |
NN |
denotes |
serum |
T5577 |
22714-22717 |
NN |
denotes |
PBS |
T5576 |
22718-22726 |
NN |
denotes |
solution |
T5578 |
22726-22728 |
, |
denotes |
, |
T5579 |
22728-22737 |
NNP |
denotes |
Molecular |
T5567 |
22738-22744 |
NNP |
denotes |
Probes |
T5580 |
22744-22745 |
-RRB- |
denotes |
) |
T5581 |
22746-22749 |
IN |
denotes |
for |
T5582 |
22750-22751 |
CD |
denotes |
3 |
T5583 |
22752-22755 |
NNS |
denotes |
hrs |
T5584 |
22756-22758 |
IN |
denotes |
at |
T5585 |
22759-22763 |
NN |
denotes |
room |
T5586 |
22764-22775 |
NN |
denotes |
temperature |
T5587 |
22775-22776 |
. |
denotes |
. |
T5588 |
22776-22935 |
sentence |
denotes |
Following final washes with 1% goat serum PBS solution, the neuronal cells on the coverslips were cover-slipped with a glycerol-based anti-photobleach medium. |
T5589 |
22777-22786 |
IN |
denotes |
Following |
T5591 |
22787-22792 |
JJ |
denotes |
final |
T5592 |
22793-22799 |
NNS |
denotes |
washes |
T5593 |
22800-22804 |
IN |
denotes |
with |
T5594 |
22805-22806 |
CD |
denotes |
1 |
T5595 |
22806-22807 |
NN |
denotes |
% |
T5597 |
22808-22812 |
NN |
denotes |
goat |
T5596 |
22813-22818 |
NN |
denotes |
serum |
T5599 |
22819-22822 |
NN |
denotes |
PBS |
T5598 |
22823-22831 |
NN |
denotes |
solution |
T5600 |
22831-22833 |
, |
denotes |
, |
T5601 |
22833-22836 |
DT |
denotes |
the |
T5603 |
22837-22845 |
JJ |
denotes |
neuronal |
T5602 |
22846-22851 |
NNS |
denotes |
cells |
T5604 |
22852-22854 |
IN |
denotes |
on |
T5605 |
22855-22858 |
DT |
denotes |
the |
T5606 |
22859-22869 |
NNS |
denotes |
coverslips |
T5607 |
22870-22874 |
VBD |
denotes |
were |
T5608 |
22875-22880 |
NN |
denotes |
cover |
T5609 |
22880-22881 |
HYPH |
denotes |
- |
T5590 |
22881-22888 |
VBN |
denotes |
slipped |
T5610 |
22889-22893 |
IN |
denotes |
with |
T5611 |
22894-22895 |
DT |
denotes |
a |
T5613 |
22896-22904 |
NN |
denotes |
glycerol |
T5615 |
22904-22905 |
HYPH |
denotes |
- |
T5614 |
22905-22910 |
VBN |
denotes |
based |
T5616 |
22911-22927 |
JJ |
denotes |
anti-photobleach |
T5612 |
22928-22934 |
NN |
denotes |
medium |
T5617 |
22934-22935 |
. |
denotes |
. |
T5618 |
22935-22999 |
sentence |
denotes |
The cells were viewed under a confocal microscope (Carl Zeiss). |
T5619 |
22936-22939 |
DT |
denotes |
The |
T5620 |
22940-22945 |
NNS |
denotes |
cells |
T5622 |
22946-22950 |
VBD |
denotes |
were |
T5621 |
22951-22957 |
VBN |
denotes |
viewed |
T5623 |
22958-22963 |
IN |
denotes |
under |
T5624 |
22964-22965 |
DT |
denotes |
a |
T5626 |
22966-22974 |
JJ |
denotes |
confocal |
T5625 |
22975-22985 |
NN |
denotes |
microscope |
T5627 |
22986-22987 |
-LRB- |
denotes |
( |
T5629 |
22987-22991 |
NNP |
denotes |
Carl |
T5628 |
22992-22997 |
NNP |
denotes |
Zeiss |
T5630 |
22997-22998 |
-RRB- |
denotes |
) |
T5631 |
22998-22999 |
. |
denotes |
. |
T5632 |
22999-23115 |
sentence |
denotes |
Images were captured with a CCD camera and acquired by the Scion Image software (Scion Corporation, Frederick, MD). |
T5633 |
23000-23006 |
NNS |
denotes |
Images |
T5635 |
23007-23011 |
VBD |
denotes |
were |
T5634 |
23012-23020 |
VBN |
denotes |
captured |
T5636 |
23021-23025 |
IN |
denotes |
with |
T5637 |
23026-23027 |
DT |
denotes |
a |
T5639 |
23028-23031 |
NN |
denotes |
CCD |
T5638 |
23032-23038 |
NN |
denotes |
camera |
T5640 |
23039-23042 |
CC |
denotes |
and |
T5641 |
23043-23051 |
VBN |
denotes |
acquired |
T5642 |
23052-23054 |
IN |
denotes |
by |
T5643 |
23055-23058 |
DT |
denotes |
the |
T5645 |
23059-23064 |
NNP |
denotes |
Scion |
T5646 |
23065-23070 |
NN |
denotes |
Image |
T5644 |
23071-23079 |
NN |
denotes |
software |
T5647 |
23080-23081 |
-LRB- |
denotes |
( |
T5649 |
23081-23086 |
NNP |
denotes |
Scion |
T5648 |
23087-23098 |
NNP |
denotes |
Corporation |
T5650 |
23098-23100 |
, |
denotes |
, |
T5651 |
23100-23109 |
NNP |
denotes |
Frederick |
T5652 |
23109-23111 |
, |
denotes |
, |
T5653 |
23111-23113 |
NNP |
denotes |
MD |
T5654 |
23113-23114 |
-RRB- |
denotes |
) |
T5655 |
23114-23115 |
. |
denotes |
. |
T5677 |
23117-23121 |
NN |
denotes |
Gene |
T5678 |
23122-23126 |
NN |
denotes |
bank |
T5680 |
23127-23136 |
NN |
denotes |
accession |
T5679 |
23137-23143 |
NN |
denotes |
number |
T5681 |
23143-23326 |
sentence |
denotes |
The cDNA sequences for the Acdp gene family have already been deposited in gene bank with accession numbers AF202994 (Acdp1), AF216961 (Acdp2), AF216964 (Acdp3) and AF216963 (Acdp4). |
T5682 |
23144-23147 |
DT |
denotes |
The |
T5684 |
23148-23152 |
NN |
denotes |
cDNA |
T5683 |
23153-23162 |
NNS |
denotes |
sequences |
T5686 |
23163-23166 |
IN |
denotes |
for |
T5687 |
23167-23170 |
DT |
denotes |
the |
T5689 |
23171-23175 |
NN |
denotes |
Acdp |
T5690 |
23176-23180 |
NN |
denotes |
gene |
T5688 |
23181-23187 |
NN |
denotes |
family |
T5691 |
23188-23192 |
VBP |
denotes |
have |
T5692 |
23193-23200 |
RB |
denotes |
already |
T5693 |
23201-23205 |
VBN |
denotes |
been |
T5685 |
23206-23215 |
VBN |
denotes |
deposited |
T5694 |
23216-23218 |
IN |
denotes |
in |
T5695 |
23219-23223 |
NN |
denotes |
gene |
T5696 |
23224-23228 |
NN |
denotes |
bank |
T5697 |
23229-23233 |
IN |
denotes |
with |
T5698 |
23234-23243 |
NN |
denotes |
accession |
T5700 |
23244-23251 |
NNS |
denotes |
numbers |
T5699 |
23252-23260 |
NN |
denotes |
AF202994 |
T5701 |
23261-23262 |
-LRB- |
denotes |
( |
T5702 |
23262-23267 |
NN |
denotes |
Acdp1 |
T5703 |
23267-23268 |
-RRB- |
denotes |
) |
T5704 |
23268-23270 |
, |
denotes |
, |
T5705 |
23270-23278 |
NN |
denotes |
AF216961 |
T5706 |
23279-23280 |
-LRB- |
denotes |
( |
T5707 |
23280-23285 |
NN |
denotes |
Acdp2 |
T5708 |
23285-23286 |
-RRB- |
denotes |
) |
T5709 |
23286-23288 |
, |
denotes |
, |
T5710 |
23288-23296 |
NN |
denotes |
AF216964 |
T5711 |
23297-23298 |
-LRB- |
denotes |
( |
T5712 |
23298-23303 |
NN |
denotes |
Acdp3 |
T5713 |
23303-23304 |
-RRB- |
denotes |
) |
T5714 |
23305-23308 |
CC |
denotes |
and |
T5715 |
23309-23317 |
NN |
denotes |
AF216963 |
T5716 |
23318-23319 |
-LRB- |
denotes |
( |
T5717 |
23319-23324 |
NN |
denotes |
Acdp4 |
T5718 |
23324-23325 |
-RRB- |
denotes |
) |
T5719 |
23325-23326 |
. |
denotes |
. |
R10 |
T226 |
T223 |
compound |
gene,family |
R100 |
T327 |
T314 |
punct |
", ",encode |
R1000 |
T2035 |
T2036 |
nmod |
nucleotide,sequences |
R1001 |
T2036 |
T2033 |
pobj |
sequences,of |
R1002 |
T2037 |
T2035 |
cc |
and,nucleotide |
R1003 |
T2038 |
T2035 |
conj |
AA,nucleotide |
R1004 |
T2039 |
T2032 |
prep |
to,homologies |
R1005 |
T2040 |
T2041 |
det |
the,genes |
R1006 |
T2041 |
T2039 |
pobj |
genes,to |
R1007 |
T2042 |
T2041 |
amod |
human,genes |
R1008 |
T2043 |
T2041 |
compound |
ACDP,genes |
R1009 |
T2044 |
T2045 |
punct |
(,Table |
R101 |
T328 |
T314 |
advmod |
respectively,encode |
R1010 |
T2045 |
T2029 |
parataxis |
Table,showed |
R1011 |
T2046 |
T2045 |
nummod |
1,Table |
R1012 |
T2047 |
T2045 |
punct |
),Table |
R1013 |
T2048 |
T2029 |
punct |
.,showed |
R1014 |
T2050 |
T2051 |
det |
The,homologies |
R1015 |
T2051 |
T2053 |
nsubjpass |
homologies,observed |
R1016 |
T2052 |
T2051 |
amod |
highest,homologies |
R1017 |
T2054 |
T2053 |
auxpass |
were,observed |
R1018 |
T2055 |
T2053 |
prep |
between,observed |
R1019 |
T2056 |
T2057 |
det |
the,ACDP2 |
R102 |
T329 |
T288 |
punct |
.,contain |
R1020 |
T2057 |
T2055 |
pobj |
ACDP2,between |
R1021 |
T2058 |
T2057 |
amod |
human,ACDP2 |
R1022 |
T2059 |
T2057 |
cc |
and,ACDP2 |
R1023 |
T2060 |
T2061 |
det |
the,Acdp2 |
R1024 |
T2061 |
T2063 |
compound |
Acdp2,gene |
R1025 |
T2062 |
T2061 |
compound |
mouse,Acdp2 |
R1026 |
T2063 |
T2057 |
conj |
gene,ACDP2 |
R1027 |
T2064 |
T2065 |
punct |
(,% |
R1028 |
T2065 |
T2053 |
parataxis |
%,observed |
R1029 |
T2066 |
T2065 |
nummod |
91,% |
R103 |
T331 |
T332 |
det |
The,genes |
R1030 |
T2067 |
T2065 |
prep |
of,% |
R1031 |
T2068 |
T2069 |
compound |
nucleotide,identity |
R1032 |
T2069 |
T2067 |
pobj |
identity,of |
R1033 |
T2070 |
T2065 |
punct |
", ",% |
R1034 |
T2071 |
T2072 |
nummod |
97,% |
R1035 |
T2072 |
T2065 |
conj |
%,% |
R1036 |
T2073 |
T2072 |
prep |
of,% |
R1037 |
T2074 |
T2075 |
compound |
AA,identity |
R1038 |
T2075 |
T2073 |
pobj |
identity,of |
R1039 |
T2076 |
T2072 |
cc |
and,% |
R104 |
T332 |
T335 |
nsubj |
genes,showed |
R1040 |
T2077 |
T2078 |
nummod |
99.4,% |
R1041 |
T2078 |
T2072 |
conj |
%,% |
R1042 |
T2079 |
T2078 |
prep |
of,% |
R1043 |
T2080 |
T2081 |
compound |
AA,homology |
R1044 |
T2081 |
T2079 |
pobj |
homology,of |
R1045 |
T2082 |
T2065 |
punct |
),% |
R1046 |
T2083 |
T2053 |
punct |
.,observed |
R1047 |
T2085 |
T2086 |
prep |
In,showed |
R1048 |
T2086 |
T2105 |
ccomp |
showed,showed |
R1049 |
T2087 |
T2085 |
pobj |
addition,In |
R105 |
T333 |
T332 |
compound |
mouse,genes |
R1050 |
T2088 |
T2086 |
punct |
", ",showed |
R1051 |
T2089 |
T2090 |
det |
the,sequences |
R1052 |
T2090 |
T2086 |
nsubj |
sequences,showed |
R1053 |
T2091 |
T2092 |
nummod |
5,UTR |
R1054 |
T2092 |
T2090 |
compound |
UTR,sequences |
R1055 |
T2093 |
T2091 |
punct |
',5 |
R1056 |
T2094 |
T2090 |
compound |
nucleotide,sequences |
R1057 |
T2095 |
T2096 |
punct |
(,bp |
R1058 |
T2096 |
T2090 |
parataxis |
bp,sequences |
R1059 |
T2097 |
T2096 |
nummod |
20,bp |
R106 |
T334 |
T332 |
compound |
Acdp,genes |
R1060 |
T2098 |
T2096 |
prep |
of,bp |
R1061 |
T2099 |
T2098 |
pobj |
nucleotides,of |
R1062 |
T2100 |
T2096 |
prep |
before,bp |
R1063 |
T2101 |
T2102 |
compound |
start,codon |
R1064 |
T2102 |
T2100 |
pobj |
codon,before |
R1065 |
T2103 |
T2096 |
punct |
),bp |
R1066 |
T2104 |
T2086 |
advmod |
also,showed |
R1067 |
T2106 |
T2107 |
amod |
high,homologies |
R1068 |
T2107 |
T2086 |
dobj |
homologies,showed |
R1069 |
T2108 |
T2107 |
prep |
to,homologies |
R107 |
T336 |
T337 |
advmod |
very,strong |
R1070 |
T2109 |
T2110 |
det |
the,homologs |
R1071 |
T2110 |
T2108 |
pobj |
homologs,to |
R1072 |
T2111 |
T2110 |
amod |
human,homologs |
R1073 |
T2112 |
T2105 |
punct |
", ",showed |
R1074 |
T2113 |
T2105 |
prep |
for,showed |
R1075 |
T2114 |
T2113 |
pobj |
example,for |
R1076 |
T2115 |
T2105 |
punct |
", ",showed |
R1077 |
T2116 |
T2117 |
det |
the,sequence |
R1078 |
T2117 |
T2105 |
nsubj |
sequence,showed |
R1079 |
T2118 |
T2117 |
nmod |
Acdp2,sequence |
R108 |
T337 |
T338 |
amod |
strong,homologies |
R1080 |
T2119 |
T2120 |
nummod |
5,UTR |
R1081 |
T2120 |
T2117 |
compound |
UTR,sequence |
R1082 |
T2121 |
T2119 |
punct |
',5 |
R1083 |
T2122 |
T2123 |
nummod |
95,% |
R1084 |
T2123 |
T2124 |
compound |
%,identities |
R1085 |
T2124 |
T2105 |
dobj |
identities,showed |
R1086 |
T2125 |
T2105 |
prep |
to,showed |
R1087 |
T2126 |
T2127 |
poss |
its,homolog |
R1088 |
T2127 |
T2125 |
pobj |
homolog,to |
R1089 |
T2128 |
T2127 |
amod |
human,homolog |
R109 |
T338 |
T335 |
dobj |
homologies,showed |
R1090 |
T2129 |
T2105 |
punct |
.,showed |
R1091 |
T2131 |
T2132 |
advmod |
However,were |
R1092 |
T2133 |
T2132 |
punct |
", ",were |
R1093 |
T2134 |
T2135 |
det |
the,homologies |
R1094 |
T2135 |
T2132 |
nsubj |
homologies,were |
R1095 |
T2136 |
T2135 |
prep |
in,homologies |
R1096 |
T2137 |
T2138 |
det |
the,sequences |
R1097 |
T2138 |
T2136 |
pobj |
sequences,in |
R1098 |
T2139 |
T2140 |
nummod |
3,UTR |
R1099 |
T2140 |
T2138 |
compound |
UTR,sequences |
R11 |
T231 |
T232 |
nsubj |
We,cloned |
R110 |
T339 |
T340 |
punct |
(,% |
R1100 |
T2141 |
T2139 |
punct |
',3 |
R1101 |
T2142 |
T2143 |
punct |
(,bp |
R1102 |
T2143 |
T2135 |
parataxis |
bp,homologies |
R1103 |
T2144 |
T2143 |
nummod |
20,bp |
R1104 |
T2145 |
T2143 |
prep |
of,bp |
R1105 |
T2146 |
T2145 |
pobj |
nucleotides,of |
R1106 |
T2147 |
T2143 |
prep |
after,bp |
R1107 |
T2148 |
T2149 |
compound |
stop,codon |
R1108 |
T2149 |
T2147 |
pobj |
codon,after |
R1109 |
T2150 |
T2143 |
punct |
),bp |
R111 |
T340 |
T338 |
parataxis |
%,homologies |
R1110 |
T2151 |
T2152 |
advmod |
much,lower |
R1111 |
T2152 |
T2132 |
acomp |
lower,were |
R1112 |
T2153 |
T2154 |
punct |
(,% |
R1113 |
T2154 |
T2132 |
parataxis |
%,were |
R1114 |
T2155 |
T2156 |
quantmod |
40,55 |
R1115 |
T2156 |
T2154 |
nummod |
55,% |
R1116 |
T2157 |
T2156 |
punct |
–,55 |
R1117 |
T2158 |
T2154 |
punct |
),% |
R1118 |
T2159 |
T2132 |
prep |
for,were |
R1119 |
T2160 |
T2161 |
det |
all,genes |
R112 |
T341 |
T342 |
punct |
>,90 |
R1120 |
T2161 |
T2159 |
pobj |
genes,for |
R1121 |
T2162 |
T2161 |
compound |
Acdp,genes |
R1122 |
T2163 |
T2161 |
prep |
except,genes |
R1123 |
T2164 |
T2163 |
pobj |
Acdp4,except |
R1124 |
T2165 |
T2166 |
punct |
(,identity |
R1125 |
T2166 |
T2164 |
parataxis |
identity,Acdp4 |
R1126 |
T2167 |
T2166 |
nummod |
90,identity |
R1127 |
T2168 |
T2167 |
quantmod |
%,90 |
R1128 |
T2169 |
T2166 |
prep |
to,identity |
R1129 |
T2170 |
T2171 |
poss |
its,homolog |
R113 |
T342 |
T340 |
nummod |
90,% |
R1130 |
T2171 |
T2169 |
pobj |
homolog,to |
R1131 |
T2172 |
T2171 |
amod |
human,homolog |
R1132 |
T2173 |
T2166 |
punct |
),identity |
R1133 |
T2174 |
T2132 |
punct |
.,were |
R1134 |
T2176 |
T2177 |
det |
The,domain |
R1135 |
T2177 |
T2180 |
nsubj |
domain,has |
R1136 |
T2178 |
T2177 |
amod |
ancient,domain |
R1137 |
T2179 |
T2177 |
amod |
conserved,domain |
R1138 |
T2181 |
T2177 |
punct |
(,domain |
R1139 |
T2182 |
T2177 |
appos |
ACD,domain |
R114 |
T343 |
T340 |
punct |
),% |
R1140 |
T2183 |
T2180 |
punct |
),has |
R1141 |
T2184 |
T2185 |
nummod |
55.3,% |
R1142 |
T2185 |
T2180 |
dobj |
%,has |
R1143 |
T2186 |
T2185 |
prep |
of,% |
R1144 |
T2187 |
T2188 |
compound |
AA,identity |
R1145 |
T2188 |
T2186 |
pobj |
identity,of |
R1146 |
T2189 |
T2185 |
cc |
and,% |
R1147 |
T2190 |
T2191 |
nummod |
83.3,% |
R1148 |
T2191 |
T2185 |
conj |
%,% |
R1149 |
T2192 |
T2191 |
prep |
of,% |
R115 |
T344 |
T338 |
prep |
in,homologies |
R1150 |
T2193 |
T2192 |
pobj |
homology,of |
R1151 |
T2194 |
T2180 |
prep |
between,has |
R1152 |
T2195 |
T2196 |
det |
all,proteins |
R1153 |
T2196 |
T2194 |
pobj |
proteins,between |
R1154 |
T2197 |
T2196 |
nmod |
mouse,proteins |
R1155 |
T2198 |
T2197 |
cc |
and,mouse |
R1156 |
T2199 |
T2197 |
conj |
human,mouse |
R1157 |
T2200 |
T2196 |
compound |
ACDP,proteins |
R1158 |
T2201 |
T2202 |
punct |
(,Fig. |
R1159 |
T2202 |
T2180 |
parataxis |
Fig.,has |
R116 |
T345 |
T346 |
preconj |
both,nucleotide |
R1160 |
T2203 |
T2202 |
nummod |
2,Fig. |
R1161 |
T2204 |
T2202 |
punct |
),Fig. |
R1162 |
T2205 |
T2180 |
punct |
.,has |
R1163 |
T2207 |
T2208 |
det |
The,domain |
R1164 |
T2208 |
T2210 |
nsubjpass |
domain,conserved |
R1165 |
T2209 |
T2208 |
compound |
ACD,domain |
R1166 |
T2211 |
T2210 |
auxpass |
is,conserved |
R1167 |
T2212 |
T2210 |
advmod |
evolutionarily,conserved |
R1168 |
T2213 |
T2210 |
prep |
in,conserved |
R1169 |
T2214 |
T2215 |
amod |
divergent,species |
R117 |
T346 |
T347 |
nmod |
nucleotide,sequences |
R1170 |
T2215 |
T2213 |
pobj |
species,in |
R1171 |
T2216 |
T2215 |
acl |
ranging,species |
R1172 |
T2217 |
T2216 |
prep |
from,ranging |
R1173 |
T2218 |
T2217 |
pobj |
bacteria,from |
R1174 |
T2219 |
T2218 |
punct |
", ",bacteria |
R1175 |
T2220 |
T2218 |
appos |
yeast,bacteria |
R1176 |
T2221 |
T2218 |
punct |
", ",bacteria |
R1177 |
T2222 |
T2223 |
compound |
C.,elegans |
R1178 |
T2223 |
T2218 |
appos |
elegans,bacteria |
R1179 |
T2224 |
T2218 |
punct |
", ",bacteria |
R118 |
T347 |
T344 |
pobj |
sequences,in |
R1180 |
T2225 |
T2226 |
compound |
D.,melanogaster |
R1181 |
T2226 |
T2218 |
appos |
melanogaster,bacteria |
R1182 |
T2227 |
T2218 |
punct |
", ",bacteria |
R1183 |
T2228 |
T2218 |
appos |
mouse,bacteria |
R1184 |
T2229 |
T2217 |
prep |
to,from |
R1185 |
T2230 |
T2229 |
pobj |
human,to |
R1186 |
T2231 |
T2232 |
punct |
(,Fig. |
R1187 |
T2232 |
T2210 |
parataxis |
Fig.,conserved |
R1188 |
T2233 |
T2232 |
nummod |
3,Fig. |
R1189 |
T2234 |
T2232 |
punct |
),Fig. |
R119 |
T348 |
T346 |
cc |
and,nucleotide |
R1190 |
T2235 |
T2210 |
punct |
.,conserved |
R1191 |
T2237 |
T2238 |
advmod |
Particularly,showed |
R1192 |
T2239 |
T2238 |
punct |
", ",showed |
R1193 |
T2240 |
T2241 |
mark |
as,shown |
R1194 |
T2241 |
T2238 |
advcl |
shown,showed |
R1195 |
T2242 |
T2241 |
prep |
in,shown |
R1196 |
T2243 |
T2242 |
pobj |
Fig.,in |
R1197 |
T2244 |
T2243 |
nummod |
3,Fig. |
R1198 |
T2245 |
T2238 |
punct |
", ",showed |
R1199 |
T2246 |
T2247 |
compound |
Acdp,proteins |
R12 |
T233 |
T232 |
aux |
have,cloned |
R120 |
T349 |
T350 |
compound |
amino,acid |
R1200 |
T2247 |
T2238 |
nsubj |
proteins,showed |
R1201 |
T2248 |
T2249 |
advmod |
very,strong |
R1202 |
T2249 |
T2250 |
amod |
strong,homology |
R1203 |
T2250 |
T2238 |
dobj |
homology,showed |
R1204 |
T2251 |
T2250 |
compound |
AA,homology |
R1205 |
T2252 |
T2250 |
prep |
to,homology |
R1206 |
T2253 |
T2254 |
compound |
bacteria,protein |
R1207 |
T2254 |
T2252 |
pobj |
protein,to |
R1208 |
T2255 |
T2254 |
compound |
CorC,protein |
R1209 |
T2256 |
T2257 |
punct |
(,identity |
R121 |
T350 |
T346 |
conj |
acid,nucleotide |
R1210 |
T2257 |
T2254 |
parataxis |
identity,protein |
R1211 |
T2258 |
T2259 |
nummod |
35,% |
R1212 |
T2259 |
T2257 |
compound |
%,identity |
R1213 |
T2260 |
T2257 |
compound |
AA,identity |
R1214 |
T2261 |
T2257 |
prep |
with,identity |
R1215 |
T2262 |
T2263 |
nummod |
55,% |
R1216 |
T2263 |
T2264 |
compound |
%,homology |
R1217 |
T2264 |
T2261 |
pobj |
homology,with |
R1218 |
T2265 |
T2257 |
punct |
),identity |
R1219 |
T2266 |
T2254 |
punct |
", ",protein |
R122 |
T351 |
T338 |
prep |
to,homologies |
R1220 |
T2267 |
T2268 |
dep |
which,involved |
R1221 |
T2268 |
T2254 |
relcl |
involved,protein |
R1222 |
T2269 |
T2268 |
auxpass |
is,involved |
R1223 |
T2270 |
T2268 |
prep |
in,involved |
R1224 |
T2271 |
T2272 |
nmod |
magnesium,efflux |
R1225 |
T2272 |
T2270 |
pobj |
efflux,in |
R1226 |
T2273 |
T2271 |
cc |
and,magnesium |
R1227 |
T2274 |
T2271 |
conj |
cobalt,magnesium |
R1228 |
T2275 |
T2276 |
punct |
[,7 |
R1229 |
T2276 |
T2238 |
parataxis |
7,showed |
R123 |
T352 |
T353 |
poss |
their,counterparts |
R1230 |
T2277 |
T2276 |
punct |
],7 |
R1231 |
T2278 |
T2238 |
punct |
.,showed |
R1232 |
T2280 |
T2281 |
amod |
High,homology |
R1233 |
T2281 |
T2283 |
nsubjpass |
homology,observed |
R1234 |
T2282 |
T2281 |
compound |
AA,homology |
R1235 |
T2284 |
T2283 |
auxpass |
was,observed |
R1236 |
T2285 |
T2283 |
advmod |
also,observed |
R1237 |
T2286 |
T2283 |
prep |
between,observed |
R1238 |
T2287 |
T2288 |
det |
the,proteins |
R1239 |
T2288 |
T2286 |
pobj |
proteins,between |
R124 |
T353 |
T351 |
pobj |
counterparts,to |
R1240 |
T2289 |
T2288 |
compound |
Acdp,proteins |
R1241 |
T2290 |
T2288 |
cc |
and,proteins |
R1242 |
T2291 |
T2292 |
det |
the,protein |
R1243 |
T2292 |
T2288 |
conj |
protein,proteins |
R1244 |
T2293 |
T2292 |
compound |
yeast,protein |
R1245 |
T2294 |
T2292 |
compound |
Amip3,protein |
R1246 |
T2295 |
T2296 |
punct |
(,identity |
R1247 |
T2296 |
T2283 |
parataxis |
identity,observed |
R1248 |
T2297 |
T2296 |
nummod |
35,identity |
R1249 |
T2298 |
T2297 |
quantmod |
%,35 |
R125 |
T354 |
T353 |
amod |
human,counterparts |
R1250 |
T2299 |
T2296 |
compound |
AA,identity |
R1251 |
T2300 |
T2296 |
prep |
with,identity |
R1252 |
T2301 |
T2302 |
nummod |
56,homology |
R1253 |
T2302 |
T2300 |
pobj |
homology,with |
R1254 |
T2303 |
T2301 |
quantmod |
%,56 |
R1255 |
T2304 |
T2296 |
punct |
),identity |
R1256 |
T2305 |
T2283 |
punct |
.,observed |
R1257 |
T2307 |
T2308 |
det |
The,Amip3 |
R1258 |
T2308 |
T2309 |
nsubj |
Amip3,is |
R1259 |
T2310 |
T2309 |
acomp |
likely,is |
R126 |
T355 |
T335 |
punct |
.,showed |
R1260 |
T2311 |
T2312 |
aux |
to,be |
R1261 |
T2312 |
T2310 |
xcomp |
be,likely |
R1262 |
T2313 |
T2314 |
det |
a,homologous |
R1263 |
T2314 |
T2312 |
attr |
homologous,be |
R1264 |
T2315 |
T2314 |
prep |
to,homologous |
R1265 |
T2316 |
T2317 |
det |
the,protein |
R1266 |
T2317 |
T2315 |
pobj |
protein,to |
R1267 |
T2318 |
T2317 |
compound |
bacteria,protein |
R1268 |
T2319 |
T2317 |
compound |
CorC,protein |
R1269 |
T2320 |
T2309 |
punct |
.,is |
R127 |
T357 |
T358 |
prep |
In,conserved |
R1270 |
T2322 |
T2323 |
det |
The,mutants |
R1271 |
T2323 |
T2325 |
nsubj |
mutants,confer |
R1272 |
T2324 |
T2323 |
compound |
Amip3,mutants |
R1273 |
T2326 |
T2325 |
dobj |
resistance,confer |
R1274 |
T2327 |
T2326 |
prep |
to,resistance |
R1275 |
T2328 |
T2329 |
compound |
copper,toxicity |
R1276 |
T2329 |
T2327 |
pobj |
toxicity,to |
R1277 |
T2330 |
T2331 |
punct |
(,Dr. |
R1278 |
T2331 |
T2325 |
meta |
Dr.,confer |
R1279 |
T2332 |
T2331 |
amod |
Personal,Dr. |
R128 |
T359 |
T357 |
pobj |
addition,In |
R1280 |
T2333 |
T2331 |
nmod |
communication,Dr. |
R1281 |
T2334 |
T2331 |
nmod |
with,Dr. |
R1282 |
T2335 |
T2331 |
nmod |
V.C.,Dr. |
R1283 |
T2336 |
T2331 |
nmod |
Culotte,Dr. |
R1284 |
T2337 |
T2331 |
punct |
", ",Dr. |
R1285 |
T2338 |
T2331 |
nmod |
John,Dr. |
R1286 |
T2339 |
T2331 |
nmod |
Hopkins,Dr. |
R1287 |
T2340 |
T2331 |
nmod |
Bloomberg,Dr. |
R1288 |
T2341 |
T2331 |
punct |
", ",Dr. |
R1289 |
T2342 |
T2331 |
nmod |
School,Dr. |
R129 |
T360 |
T358 |
punct |
", ",conserved |
R1290 |
T2343 |
T2331 |
nmod |
of,Dr. |
R1291 |
T2344 |
T2331 |
nmod |
Public,Dr. |
R1292 |
T2345 |
T2331 |
nmod |
Health,Dr. |
R1293 |
T2346 |
T2331 |
punct |
),Dr. |
R1294 |
T2347 |
T2325 |
punct |
.,confer |
R1295 |
T2349 |
T2350 |
det |
The,relationships |
R1296 |
T2350 |
T2352 |
nsubjpass |
relationships,illustrated |
R1297 |
T2351 |
T2350 |
amod |
evolutionary,relationships |
R1298 |
T2353 |
T2350 |
prep |
among,relationships |
R1299 |
T2354 |
T2355 |
det |
those,proteins |
R13 |
T234 |
T232 |
advmod |
recently,cloned |
R130 |
T361 |
T362 |
preconj |
both,nucleotide |
R1300 |
T2355 |
T2353 |
pobj |
proteins,among |
R1301 |
T2356 |
T2352 |
auxpass |
are,illustrated |
R1302 |
T2357 |
T2352 |
prep |
by,illustrated |
R1303 |
T2358 |
T2359 |
det |
a,tree |
R1304 |
T2359 |
T2357 |
pobj |
tree,by |
R1305 |
T2360 |
T2359 |
amod |
phylogenetic,tree |
R1306 |
T2361 |
T2359 |
acl |
constructed,tree |
R1307 |
T2362 |
T2361 |
prep |
based,constructed |
R1308 |
T2363 |
T2362 |
prep |
on,based |
R1309 |
T2364 |
T2365 |
det |
the,homology |
R131 |
T362 |
T363 |
nmod |
nucleotide,sequences |
R1310 |
T2365 |
T2363 |
pobj |
homology,on |
R1311 |
T2366 |
T2365 |
compound |
AA,homology |
R1312 |
T2367 |
T2365 |
prep |
of,homology |
R1313 |
T2368 |
T2367 |
pobj |
proteins,of |
R1314 |
T2369 |
T2370 |
punct |
(,Fig. |
R1315 |
T2370 |
T2352 |
parataxis |
Fig.,illustrated |
R1316 |
T2371 |
T2370 |
nummod |
4,Fig. |
R1317 |
T2372 |
T2370 |
punct |
),Fig. |
R1318 |
T2373 |
T2352 |
punct |
.,illustrated |
R1319 |
T2376 |
T2377 |
nsubj |
We,found |
R132 |
T363 |
T358 |
nsubjpass |
sequences,conserved |
R1320 |
T2378 |
T2379 |
mark |
that,contain |
R1321 |
T2379 |
T2377 |
ccomp |
contain,found |
R1322 |
T2380 |
T2381 |
det |
all,members |
R1323 |
T2381 |
T2379 |
nsubj |
members,contain |
R1324 |
T2382 |
T2381 |
compound |
mouse,members |
R1325 |
T2383 |
T2381 |
compound |
Acdp,members |
R1326 |
T2384 |
T2385 |
nummod |
four,domains |
R1327 |
T2385 |
T2379 |
dobj |
domains,contain |
R1328 |
T2386 |
T2385 |
amod |
distinct,domains |
R1329 |
T2387 |
T2385 |
compound |
transmembrane,domains |
R133 |
T364 |
T362 |
cc |
and,nucleotide |
R1330 |
T2388 |
T2389 |
punct |
(,Fig. |
R1331 |
T2389 |
T2385 |
parataxis |
Fig.,domains |
R1332 |
T2390 |
T2389 |
nummod |
5,Fig. |
R1333 |
T2391 |
T2389 |
punct |
),Fig. |
R1334 |
T2392 |
T2385 |
punct |
", ",domains |
R1335 |
T2393 |
T2394 |
nummod |
two,domains |
R1336 |
T2394 |
T2385 |
conj |
domains,domains |
R1337 |
T2395 |
T2394 |
compound |
CBS,domains |
R1338 |
T2396 |
T2394 |
cc |
and,domains |
R1339 |
T2397 |
T2398 |
det |
a,domain |
R134 |
T365 |
T366 |
compound |
amino,acid |
R1340 |
T2398 |
T2394 |
conj |
domain,domains |
R1341 |
T2399 |
T2398 |
compound |
DUF21,domain |
R1342 |
T2400 |
T2401 |
dep |
that,found |
R1343 |
T2401 |
T2385 |
relcl |
found,domains |
R1344 |
T2402 |
T2401 |
auxpass |
are,found |
R1345 |
T2403 |
T2401 |
prep |
in,found |
R1346 |
T2404 |
T2405 |
nmod |
bacteria,CorC |
R1347 |
T2405 |
T2406 |
nmod |
CorC,proteins |
R1348 |
T2406 |
T2403 |
pobj |
proteins,in |
R1349 |
T2407 |
T2405 |
cc |
and,CorC |
R135 |
T366 |
T362 |
conj |
acid,nucleotide |
R1350 |
T2408 |
T2409 |
compound |
yeast,Amip3 |
R1351 |
T2409 |
T2405 |
conj |
Amip3,CorC |
R1352 |
T2410 |
T2377 |
punct |
.,found |
R1353 |
T2412 |
T2413 |
compound |
CBS,domains |
R1354 |
T2413 |
T2414 |
nsubj |
domains,are |
R1355 |
T2415 |
T2416 |
amod |
small,modules |
R1356 |
T2416 |
T2414 |
attr |
modules,are |
R1357 |
T2417 |
T2416 |
amod |
intracellular,modules |
R1358 |
T2418 |
T2419 |
dep |
that,found |
R1359 |
T2419 |
T2416 |
relcl |
found,modules |
R136 |
T367 |
T363 |
prep |
within,sequences |
R1360 |
T2420 |
T2419 |
auxpass |
are,found |
R1361 |
T2421 |
T2419 |
advmod |
mostly,found |
R1362 |
T2422 |
T2419 |
prep |
in,found |
R1363 |
T2423 |
T2424 |
nummod |
2,copies |
R1364 |
T2424 |
T2422 |
pobj |
copies,in |
R1365 |
T2425 |
T2423 |
cc |
or,2 |
R1366 |
T2426 |
T2423 |
conj |
four,2 |
R1367 |
T2427 |
T2419 |
prep |
within,found |
R1368 |
T2428 |
T2429 |
det |
a,protein |
R1369 |
T2429 |
T2427 |
pobj |
protein,within |
R137 |
T368 |
T369 |
det |
the,Domain |
R1370 |
T2430 |
T2414 |
punct |
.,are |
R1371 |
T2432 |
T2433 |
nsubj |
Pairs,dimerise |
R1372 |
T2434 |
T2432 |
prep |
of,Pairs |
R1373 |
T2435 |
T2436 |
compound |
CBS,domains |
R1374 |
T2436 |
T2434 |
pobj |
domains,of |
R1375 |
T2437 |
T2438 |
aux |
to,form |
R1376 |
T2438 |
T2433 |
advcl |
form,dimerise |
R1377 |
T2439 |
T2440 |
det |
a,domain |
R1378 |
T2440 |
T2438 |
dobj |
domain,form |
R1379 |
T2441 |
T2440 |
amod |
stable,domain |
R138 |
T369 |
T367 |
pobj |
Domain,within |
R1380 |
T2442 |
T2440 |
amod |
globular,domain |
R1381 |
T2443 |
T2444 |
punct |
[,8 |
R1382 |
T2444 |
T2433 |
parataxis |
8,dimerise |
R1383 |
T2445 |
T2444 |
punct |
],8 |
R1384 |
T2446 |
T2433 |
punct |
.,dimerise |
R1385 |
T2448 |
T2449 |
nsubj |
DUF21,is |
R1386 |
T2450 |
T2451 |
punct |
(,pfam01959.9 |
R1387 |
T2451 |
T2448 |
parataxis |
pfam01959.9,DUF21 |
R1388 |
T2452 |
T2451 |
dep |
CD,pfam01959.9 |
R1389 |
T2453 |
T2451 |
punct |
: ,pfam01959.9 |
R139 |
T370 |
T369 |
amod |
Ancient,Domain |
R1390 |
T2454 |
T2451 |
punct |
),pfam01959.9 |
R1391 |
T2455 |
T2456 |
det |
a,domain |
R1392 |
T2456 |
T2449 |
attr |
domain,is |
R1393 |
T2457 |
T2458 |
advmod |
newly,defined |
R1394 |
T2458 |
T2456 |
amod |
defined,domain |
R1395 |
T2459 |
T2456 |
prep |
with,domain |
R1396 |
T2460 |
T2461 |
amod |
unknown,function |
R1397 |
T2461 |
T2459 |
pobj |
function,with |
R1398 |
T2462 |
T2449 |
punct |
.,is |
R1399 |
T2464 |
T2465 |
det |
This,domain |
R14 |
T235 |
T232 |
cc |
and,cloned |
R140 |
T371 |
T369 |
amod |
Conserved,Domain |
R1400 |
T2465 |
T2466 |
nsubj |
domain,is |
R1401 |
T2467 |
T2468 |
det |
a,region |
R1402 |
T2468 |
T2466 |
attr |
region,is |
R1403 |
T2469 |
T2468 |
amod |
transmembrane,region |
R1404 |
T2470 |
T2468 |
cc |
and,region |
R1405 |
T2471 |
T2468 |
conj |
found,region |
R1406 |
T2472 |
T2473 |
aux |
to,located |
R1407 |
T2473 |
T2471 |
xcomp |
located,found |
R1408 |
T2474 |
T2473 |
auxpass |
be,located |
R1409 |
T2475 |
T2473 |
prep |
in,located |
R141 |
T372 |
T369 |
punct |
(,Domain |
R1410 |
T2476 |
T2477 |
det |
the,terminus |
R1411 |
T2477 |
T2475 |
pobj |
terminus,in |
R1412 |
T2478 |
T2477 |
compound |
N,terminus |
R1413 |
T2479 |
T2477 |
punct |
-,terminus |
R1414 |
T2480 |
T2477 |
prep |
of,terminus |
R1415 |
T2481 |
T2482 |
det |
the,proteins |
R1416 |
T2482 |
T2480 |
pobj |
proteins,of |
R1417 |
T2483 |
T2482 |
amod |
adjacent,proteins |
R1418 |
T2484 |
T2483 |
prep |
to,adjacent |
R1419 |
T2485 |
T2486 |
nummod |
two,domains |
R142 |
T373 |
T369 |
appos |
ACD,Domain |
R1420 |
T2486 |
T2484 |
pobj |
domains,to |
R1421 |
T2487 |
T2486 |
amod |
intracellular,domains |
R1422 |
T2488 |
T2486 |
compound |
CBS,domains |
R1423 |
T2489 |
T2466 |
punct |
.,is |
R1424 |
T2491 |
T2492 |
det |
A,domain |
R1425 |
T2492 |
T2496 |
nsubjpass |
domain,found |
R1426 |
T2493 |
T2494 |
npadvmod |
cNMP,binding |
R1427 |
T2494 |
T2492 |
amod |
binding,domain |
R1428 |
T2495 |
T2494 |
punct |
-,binding |
R1429 |
T2497 |
T2498 |
punct |
(,domain |
R143 |
T374 |
T358 |
punct |
),conserved |
R1430 |
T2498 |
T2492 |
parataxis |
domain,domain |
R1431 |
T2499 |
T2500 |
amod |
cyclic,monophosphate |
R1432 |
T2500 |
T2498 |
nmod |
monophosphate,domain |
R1433 |
T2501 |
T2500 |
nmod |
nucleotide,monophosphate |
R1434 |
T2502 |
T2500 |
punct |
-,monophosphate |
R1435 |
T2503 |
T2500 |
punct |
-,monophosphate |
R1436 |
T2504 |
T2500 |
amod |
binding,monophosphate |
R1437 |
T2505 |
T2498 |
punct |
),domain |
R1438 |
T2506 |
T2496 |
auxpass |
was,found |
R1439 |
T2507 |
T2496 |
prep |
in,found |
R144 |
T375 |
T358 |
auxpass |
are,conserved |
R1440 |
T2508 |
T2509 |
det |
all,members |
R1441 |
T2509 |
T2507 |
pobj |
members,in |
R1442 |
T2510 |
T2509 |
compound |
Acdp,members |
R1443 |
T2511 |
T2496 |
punct |
.,found |
R1444 |
T2513 |
T2514 |
prep |
In,contains |
R1445 |
T2515 |
T2513 |
pobj |
addition,In |
R1446 |
T2516 |
T2514 |
punct |
", ",contains |
R1447 |
T2517 |
T2514 |
nsubj |
Acdp1,contains |
R1448 |
T2518 |
T2519 |
det |
an,region |
R1449 |
T2519 |
T2514 |
dobj |
region,contains |
R145 |
T376 |
T358 |
advmod |
highly,conserved |
R1450 |
T2520 |
T2521 |
npadvmod |
Alanine,rich |
R1451 |
T2521 |
T2519 |
amod |
rich,region |
R1452 |
T2522 |
T2521 |
punct |
-,rich |
R1453 |
T2523 |
T2524 |
punct |
(,AAAAAAAAA |
R1454 |
T2524 |
T2519 |
parataxis |
AAAAAAAAA,region |
R1455 |
T2525 |
T2524 |
dep |
2,AAAAAAAAA |
R1456 |
T2526 |
T2527 |
punct |
–,10 |
R1457 |
T2527 |
T2525 |
prep |
10,2 |
R1458 |
T2528 |
T2524 |
punct |
: ,AAAAAAAAA |
R1459 |
T2529 |
T2524 |
punct |
),AAAAAAAAA |
R146 |
T377 |
T358 |
prep |
in,conserved |
R1460 |
T2530 |
T2519 |
punct |
", ",region |
R1461 |
T2531 |
T2532 |
det |
a,region |
R1462 |
T2532 |
T2519 |
conj |
region,region |
R1463 |
T2533 |
T2534 |
npadvmod |
Leucine,rich |
R1464 |
T2534 |
T2532 |
amod |
rich,region |
R1465 |
T2535 |
T2534 |
punct |
-,rich |
R1466 |
T2536 |
T2537 |
punct |
(,SGLRLSLLSLDPVELRVL |
R1467 |
T2537 |
T2532 |
parataxis |
SGLRLSLLSLDPVELRVL,region |
R1468 |
T2538 |
T2537 |
dep |
204,SGLRLSLLSLDPVELRVL |
R1469 |
T2539 |
T2540 |
punct |
–,257 |
R147 |
T378 |
T379 |
amod |
many,species |
R1470 |
T2540 |
T2538 |
prep |
257,204 |
R1471 |
T2541 |
T2537 |
punct |
: ,SGLRLSLLSLDPVELRVL |
R1472 |
T2542 |
T2537 |
compound |
LLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALF,SGLRLSLLSLDPVELRVL |
R1473 |
T2543 |
T2537 |
punct |
),SGLRLSLLSLDPVELRVL |
R1474 |
T2544 |
T2532 |
punct |
", ",region |
R1475 |
T2545 |
T2546 |
det |
a,region |
R1476 |
T2546 |
T2532 |
conj |
region,region |
R1477 |
T2547 |
T2548 |
npadvmod |
Proline,rich |
R1478 |
T2548 |
T2546 |
amod |
rich,region |
R1479 |
T2549 |
T2548 |
punct |
-,rich |
R148 |
T379 |
T377 |
pobj |
species,in |
R1480 |
T2550 |
T2551 |
punct |
(,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1481 |
T2551 |
T2546 |
parataxis |
PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP,region |
R1482 |
T2552 |
T2551 |
dep |
78,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1483 |
T2553 |
T2554 |
punct |
–,130 |
R1484 |
T2554 |
T2552 |
prep |
130,78 |
R1485 |
T2555 |
T2551 |
punct |
: ,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1486 |
T2556 |
T2551 |
compound |
PGPPVPAAPVPAPSLA,PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1487 |
T2557 |
T2551 |
punct |
),PGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGP |
R1488 |
T2558 |
T2546 |
punct |
", ",region |
R1489 |
T2559 |
T2546 |
cc |
and,region |
R149 |
T380 |
T379 |
amod |
different,species |
R1490 |
T2560 |
T2561 |
nummod |
two,sites |
R1491 |
T2561 |
T2546 |
conj |
sites,region |
R1492 |
T2562 |
T2561 |
compound |
amidation,sites |
R1493 |
T2563 |
T2564 |
punct |
(,SGRK |
R1494 |
T2564 |
T2561 |
parataxis |
SGRK,sites |
R1495 |
T2565 |
T2566 |
dep |
917,MGKK |
R1496 |
T2566 |
T2564 |
dep |
MGKK,SGRK |
R1497 |
T2567 |
T2568 |
punct |
–,920 |
R1498 |
T2568 |
T2565 |
prep |
920,917 |
R1499 |
T2569 |
T2566 |
punct |
: ,MGKK |
R15 |
T236 |
T232 |
conj |
characterized,cloned |
R150 |
T381 |
T379 |
amod |
taxonomic,species |
R1500 |
T2570 |
T2564 |
punct |
;,SGRK |
R1501 |
T2571 |
T2564 |
dep |
926,SGRK |
R1502 |
T2572 |
T2573 |
punct |
–,929 |
R1503 |
T2573 |
T2571 |
prep |
929,926 |
R1504 |
T2574 |
T2564 |
punct |
: ,SGRK |
R1505 |
T2575 |
T2564 |
punct |
),SGRK |
R1506 |
T2576 |
T2514 |
punct |
.,contains |
R1507 |
T2578 |
T2579 |
nsubj |
Acdp2,has |
R1508 |
T2580 |
T2581 |
det |
a,region |
R1509 |
T2581 |
T2579 |
dobj |
region,has |
R151 |
T382 |
T358 |
punct |
.,conserved |
R1510 |
T2582 |
T2583 |
npadvmod |
glycine,rich |
R1511 |
T2583 |
T2581 |
amod |
rich,region |
R1512 |
T2584 |
T2583 |
punct |
-,rich |
R1513 |
T2585 |
T2586 |
punct |
(,GAGGSGSASGTVGGKGGAGVAG |
R1514 |
T2586 |
T2581 |
parataxis |
GAGGSGSASGTVGGKGGAGVAG,region |
R1515 |
T2587 |
T2586 |
dep |
201,GAGGSGSASGTVGGKGGAGVAG |
R1516 |
T2588 |
T2589 |
punct |
–,222 |
R1517 |
T2589 |
T2587 |
prep |
222,201 |
R1518 |
T2590 |
T2586 |
punct |
: ,GAGGSGSASGTVGGKGGAGVAG |
R1519 |
T2591 |
T2586 |
punct |
),GAGGSGSASGTVGGKGGAGVAG |
R152 |
T384 |
T385 |
advmod |
Particularly,showed |
R1520 |
T2592 |
T2579 |
punct |
.,has |
R1521 |
T2594 |
T2595 |
nsubj |
Acdp3,possesses |
R1522 |
T2596 |
T2597 |
det |
a,region |
R1523 |
T2597 |
T2595 |
dobj |
region,possesses |
R1524 |
T2598 |
T2597 |
amod |
large,region |
R1525 |
T2599 |
T2600 |
npadvmod |
alanine,rich |
R1526 |
T2600 |
T2597 |
amod |
rich,region |
R1527 |
T2601 |
T2600 |
punct |
-,rich |
R1528 |
T2602 |
T2603 |
punct |
(,2 |
R1529 |
T2603 |
T2597 |
parataxis |
2,region |
R153 |
T386 |
T385 |
punct |
", ",showed |
R1530 |
T2604 |
T2605 |
punct |
–,261 |
R1531 |
T2605 |
T2603 |
prep |
261,2 |
R1532 |
T2606 |
T2603 |
punct |
),2 |
R1533 |
T2607 |
T2597 |
cc |
and,region |
R1534 |
T2608 |
T2609 |
det |
a,region |
R1535 |
T2609 |
T2597 |
conj |
region,region |
R1536 |
T2610 |
T2609 |
amod |
large,region |
R1537 |
T2611 |
T2612 |
npadvmod |
leucine,rich |
R1538 |
T2612 |
T2609 |
amod |
rich,region |
R1539 |
T2613 |
T2612 |
punct |
-,rich |
R154 |
T387 |
T388 |
compound |
Acdp,proteins |
R1540 |
T2614 |
T2615 |
punct |
(,201 |
R1541 |
T2615 |
T2609 |
parataxis |
201,region |
R1542 |
T2616 |
T2617 |
punct |
–,299 |
R1543 |
T2617 |
T2615 |
prep |
299,201 |
R1544 |
T2618 |
T2615 |
punct |
),201 |
R1545 |
T2619 |
T2595 |
punct |
.,possesses |
R1546 |
T2621 |
T2622 |
nsubj |
Acdp4,contains |
R1547 |
T2623 |
T2624 |
det |
a,pattern |
R1548 |
T2624 |
T2622 |
dobj |
pattern,contains |
R1549 |
T2625 |
T2624 |
compound |
leucine,pattern |
R155 |
T388 |
T385 |
nsubj |
proteins,showed |
R1550 |
T2626 |
T2624 |
compound |
zipper,pattern |
R1551 |
T2627 |
T2628 |
punct |
(,LVMVLLVLSGIFSGLNLGLMAL |
R1552 |
T2628 |
T2624 |
parataxis |
LVMVLLVLSGIFSGLNLGLMAL,pattern |
R1553 |
T2629 |
T2628 |
dep |
185,LVMVLLVLSGIFSGLNLGLMAL |
R1554 |
T2630 |
T2631 |
punct |
–,206 |
R1555 |
T2631 |
T2629 |
prep |
206,185 |
R1556 |
T2632 |
T2628 |
punct |
: ,LVMVLLVLSGIFSGLNLGLMAL |
R1557 |
T2633 |
T2628 |
punct |
),LVMVLLVLSGIFSGLNLGLMAL |
R1558 |
T2634 |
T2624 |
cc |
and,pattern |
R1559 |
T2635 |
T2636 |
det |
an,site |
R156 |
T389 |
T390 |
advmod |
very,strong |
R1560 |
T2636 |
T2624 |
conj |
site,pattern |
R1561 |
T2637 |
T2636 |
compound |
amidation,site |
R1562 |
T2638 |
T2639 |
punct |
(,GGRR |
R1563 |
T2639 |
T2636 |
parataxis |
GGRR,site |
R1564 |
T2640 |
T2639 |
dep |
7,GGRR |
R1565 |
T2641 |
T2642 |
punct |
–,10 |
R1566 |
T2642 |
T2640 |
prep |
10,7 |
R1567 |
T2643 |
T2639 |
punct |
: ,GGRR |
R1568 |
T2644 |
T2639 |
punct |
),GGRR |
R1569 |
T2645 |
T2622 |
punct |
.,contains |
R157 |
T390 |
T391 |
amod |
strong,homologies |
R1572 |
T2862 |
T2863 |
compound |
Antibody,production |
R1573 |
T2864 |
T2863 |
punct |
", ",production |
R1574 |
T2865 |
T2866 |
compound |
Western,results |
R1575 |
T2866 |
T2863 |
conj |
results,production |
R1576 |
T2867 |
T2866 |
cc |
and,results |
R1577 |
T2868 |
T2869 |
amod |
subcellular,localization |
R1578 |
T2869 |
T2866 |
conj |
localization,results |
R1579 |
T2871 |
T2872 |
nsubjpass |
Peptides,synthesized |
R158 |
T391 |
T385 |
dobj |
homologies,showed |
R1580 |
T2873 |
T2871 |
prep |
from,Peptides |
R1581 |
T2874 |
T2875 |
nmod |
Acdp1,terminuses |
R1582 |
T2875 |
T2873 |
pobj |
terminuses,from |
R1583 |
T2876 |
T2875 |
nmod |
N,terminuses |
R1584 |
T2877 |
T2876 |
punct |
-,N |
R1585 |
T2878 |
T2876 |
punct |
(,N |
R1586 |
T2879 |
T2876 |
appos |
TSFLLRVYFQPGPPATAAPVPSPT,N |
R1587 |
T2880 |
T2876 |
punct |
),N |
R1588 |
T2881 |
T2876 |
cc |
and,N |
R1589 |
T2882 |
T2876 |
conj |
C,N |
R159 |
T392 |
T391 |
compound |
AA,homologies |
R1590 |
T2883 |
T2882 |
punct |
-,C |
R1591 |
T2884 |
T2882 |
punct |
(,C |
R1592 |
T2885 |
T2882 |
appos |
TQQLTLSPAAVPTR,C |
R1593 |
T2886 |
T2875 |
punct |
),terminuses |
R1594 |
T2887 |
T2871 |
punct |
", ",Peptides |
R1595 |
T2888 |
T2889 |
amod |
conserved,peptide |
R1596 |
T2889 |
T2871 |
appos |
peptide,Peptides |
R1597 |
T2890 |
T2889 |
prep |
from,peptide |
R1598 |
T2891 |
T2892 |
compound |
ACD,domain |
R1599 |
T2892 |
T2890 |
pobj |
domain,from |
R16 |
T237 |
T238 |
det |
a,family |
R160 |
T393 |
T391 |
prep |
to,homologies |
R1600 |
T2893 |
T2892 |
prep |
of,domain |
R1601 |
T2894 |
T2893 |
pobj |
Acdp1,of |
R1602 |
T2895 |
T2894 |
punct |
(,Acdp1 |
R1603 |
T2896 |
T2894 |
appos |
HNIVDILFVKDLAFVDPDDCTPLLTVTRF,Acdp1 |
R1604 |
T2897 |
T2872 |
punct |
),synthesized |
R1605 |
T2898 |
T2872 |
auxpass |
were,synthesized |
R1606 |
T2899 |
T2872 |
advmod |
commercially,synthesized |
R1607 |
T2900 |
T2901 |
punct |
(,Genosys |
R1608 |
T2901 |
T2872 |
parataxis |
Genosys,synthesized |
R1609 |
T2902 |
T2901 |
compound |
Sigma,Genosys |
R161 |
T394 |
T395 |
det |
the,protein |
R1610 |
T2903 |
T2901 |
punct |
),Genosys |
R1611 |
T2904 |
T2872 |
punct |
.,synthesized |
R1612 |
T2906 |
T2907 |
det |
These,sites |
R1613 |
T2907 |
T2909 |
nsubjpass |
sites,predicted |
R1614 |
T2908 |
T2907 |
amod |
antigenic,sites |
R1615 |
T2910 |
T2909 |
auxpass |
were,predicted |
R1616 |
T2911 |
T2909 |
prep |
by,predicted |
R1617 |
T2912 |
T2911 |
pobj |
software,by |
R1618 |
T2913 |
T2912 |
prep |
from,software |
R1619 |
T2914 |
T2915 |
compound |
Sigma,Genosys |
R162 |
T395 |
T393 |
pobj |
protein,to |
R1620 |
T2915 |
T2913 |
pobj |
Genosys,from |
R1621 |
T2916 |
T2909 |
cc |
and,predicted |
R1622 |
T2917 |
T2918 |
amod |
polyclonal,antibodies |
R1623 |
T2918 |
T2919 |
nsubjpass |
antibodies,produced |
R1624 |
T2919 |
T2909 |
conj |
produced,predicted |
R1625 |
T2920 |
T2918 |
prep |
for,antibodies |
R1626 |
T2921 |
T2922 |
det |
each,peptide |
R1627 |
T2922 |
T2920 |
pobj |
peptide,for |
R1628 |
T2923 |
T2919 |
auxpass |
were,produced |
R1629 |
T2924 |
T2919 |
prep |
by,produced |
R163 |
T396 |
T395 |
compound |
bacteria,protein |
R1630 |
T2925 |
T2924 |
pcomp |
immunizing,by |
R1631 |
T2926 |
T2925 |
dobj |
rabbits,immunizing |
R1632 |
T2927 |
T2919 |
punct |
.,produced |
R1633 |
T2929 |
T2930 |
aux |
To,test |
R1634 |
T2930 |
T2931 |
advcl |
test,conducted |
R1635 |
T2932 |
T2933 |
det |
the,specificity |
R1636 |
T2933 |
T2930 |
dobj |
specificity,test |
R1637 |
T2934 |
T2933 |
prep |
of,specificity |
R1638 |
T2935 |
T2936 |
det |
the,antibodies |
R1639 |
T2936 |
T2934 |
pobj |
antibodies,of |
R164 |
T397 |
T395 |
compound |
CorC,protein |
R1640 |
T2937 |
T2931 |
punct |
", ",conducted |
R1641 |
T2938 |
T2931 |
nsubj |
we,conducted |
R1642 |
T2939 |
T2940 |
compound |
Western,blot |
R1643 |
T2940 |
T2942 |
compound |
blot,analysis |
R1644 |
T2941 |
T2940 |
punct |
-,blot |
R1645 |
T2942 |
T2931 |
dobj |
analysis,conducted |
R1646 |
T2943 |
T2942 |
prep |
of,analysis |
R1647 |
T2944 |
T2945 |
compound |
mouse,brain |
R1648 |
T2945 |
T2946 |
compound |
brain,tissue |
R1649 |
T2946 |
T2947 |
compound |
tissue,extracts |
R165 |
T398 |
T399 |
punct |
(,identity |
R1650 |
T2947 |
T2943 |
pobj |
extracts,of |
R1651 |
T2948 |
T2931 |
punct |
.,conducted |
R1652 |
T2950 |
T2951 |
mark |
As,shown |
R1653 |
T2951 |
T2952 |
advcl |
shown,detected |
R1654 |
T2953 |
T2951 |
prep |
in,shown |
R1655 |
T2954 |
T2953 |
pobj |
Fig.,in |
R1656 |
T2955 |
T2954 |
nummod |
6A,Fig. |
R1657 |
T2956 |
T2952 |
punct |
", ",detected |
R1658 |
T2957 |
T2958 |
det |
the,antibody |
R1659 |
T2958 |
T2952 |
nsubj |
antibody,detected |
R166 |
T399 |
T395 |
parataxis |
identity,protein |
R1660 |
T2959 |
T2958 |
acl |
produced,antibody |
R1661 |
T2960 |
T2959 |
prep |
by,produced |
R1662 |
T2961 |
T2962 |
nmod |
C,peptide |
R1663 |
T2962 |
T2960 |
pobj |
peptide,by |
R1664 |
T2963 |
T2961 |
punct |
-,C |
R1665 |
T2964 |
T2961 |
amod |
terminal,C |
R1666 |
T2965 |
T2952 |
advmod |
specifically,detected |
R1667 |
T2966 |
T2952 |
dobj |
Acdp1,detected |
R1668 |
T2967 |
T2968 |
punct |
(,lane |
R1669 |
T2968 |
T2952 |
parataxis |
lane,detected |
R167 |
T400 |
T401 |
nummod |
35,% |
R1670 |
T2969 |
T2968 |
nummod |
3,lane |
R1671 |
T2970 |
T2968 |
punct |
),lane |
R1672 |
T2971 |
T2952 |
punct |
.,detected |
R1673 |
T2973 |
T2974 |
det |
The,antibody |
R1674 |
T2974 |
T2975 |
nsubj |
antibody,recognized |
R1675 |
T2976 |
T2974 |
acl |
generated,antibody |
R1676 |
T2977 |
T2976 |
agent |
by,generated |
R1677 |
T2978 |
T2979 |
nmod |
N,peptide |
R1678 |
T2979 |
T2977 |
pobj |
peptide,by |
R1679 |
T2980 |
T2978 |
punct |
-,N |
R168 |
T401 |
T399 |
compound |
%,identity |
R1680 |
T2981 |
T2978 |
amod |
terminal,N |
R1681 |
T2982 |
T2975 |
dobj |
Acdp4,recognized |
R1682 |
T2983 |
T2975 |
prep |
in,recognized |
R1683 |
T2984 |
T2983 |
pobj |
addition,in |
R1684 |
T2985 |
T2984 |
prep |
to,addition |
R1685 |
T2986 |
T2985 |
pobj |
Acdp1,to |
R1686 |
T2987 |
T2975 |
punct |
", ",recognized |
R1687 |
T2988 |
T2989 |
mark |
although,was |
R1688 |
T2989 |
T2975 |
advcl |
was,recognized |
R1689 |
T2990 |
T2991 |
det |
the,reactivity |
R169 |
T402 |
T399 |
compound |
AA,identity |
R1690 |
T2991 |
T2989 |
nsubj |
reactivity,was |
R1691 |
T2992 |
T2991 |
prep |
to,reactivity |
R1692 |
T2993 |
T2992 |
pobj |
latter,to |
R1693 |
T2994 |
T2995 |
advmod |
significantly,higher |
R1694 |
T2995 |
T2989 |
acomp |
higher,was |
R1695 |
T2996 |
T2997 |
punct |
(,lane |
R1696 |
T2997 |
T2975 |
parataxis |
lane,recognized |
R1697 |
T2998 |
T2997 |
dep |
Fig.,lane |
R1698 |
T2999 |
T2998 |
nummod |
6A,Fig. |
R1699 |
T3000 |
T2997 |
punct |
", ",lane |
R17 |
T238 |
T236 |
dobj |
family,characterized |
R170 |
T403 |
T399 |
prep |
with,identity |
R1700 |
T3001 |
T2997 |
nummod |
2,lane |
R1701 |
T3002 |
T2997 |
punct |
),lane |
R1702 |
T3003 |
T2975 |
punct |
.,recognized |
R1703 |
T3005 |
T3006 |
mark |
As,expected |
R1704 |
T3006 |
T3007 |
advcl |
expected,detected |
R1705 |
T3008 |
T3007 |
punct |
", ",detected |
R1706 |
T3009 |
T3010 |
det |
the,antibody |
R1707 |
T3010 |
T3007 |
nsubj |
antibody,detected |
R1708 |
T3011 |
T3010 |
acl |
produced,antibody |
R1709 |
T3012 |
T3011 |
agent |
by,produced |
R171 |
T404 |
T405 |
nummod |
55,% |
R1710 |
T3013 |
T3014 |
det |
the,peptide |
R1711 |
T3014 |
T3012 |
pobj |
peptide,by |
R1712 |
T3015 |
T3014 |
amod |
conserved,peptide |
R1713 |
T3016 |
T3014 |
compound |
sequence,peptide |
R1714 |
T3017 |
T3018 |
det |
all,proteins |
R1715 |
T3018 |
T3007 |
dobj |
proteins,detected |
R1716 |
T3019 |
T3018 |
compound |
Acdp,proteins |
R1717 |
T3020 |
T3021 |
punct |
(,lane |
R1718 |
T3021 |
T3007 |
parataxis |
lane,detected |
R1719 |
T3022 |
T3021 |
dep |
Fig.,lane |
R172 |
T405 |
T406 |
compound |
%,homology |
R1720 |
T3023 |
T3022 |
nummod |
6A,Fig. |
R1721 |
T3024 |
T3021 |
punct |
", ",lane |
R1722 |
T3025 |
T3021 |
nummod |
1,lane |
R1723 |
T3026 |
T3021 |
punct |
),lane |
R1724 |
T3027 |
T3007 |
punct |
.,detected |
R1725 |
T3029 |
T3030 |
aux |
To,determine |
R1726 |
T3030 |
T3032 |
advcl |
determine,analyzed |
R1727 |
T3031 |
T3030 |
advmod |
further,determine |
R1728 |
T3033 |
T3034 |
det |
the,specificity |
R1729 |
T3034 |
T3030 |
dobj |
specificity,determine |
R173 |
T406 |
T403 |
pobj |
homology,with |
R1730 |
T3035 |
T3034 |
prep |
of,specificity |
R1731 |
T3036 |
T3037 |
det |
the,antibody |
R1732 |
T3037 |
T3035 |
pobj |
antibody,of |
R1733 |
T3038 |
T3034 |
prep |
against,specificity |
R1734 |
T3039 |
T3040 |
det |
the,terminus |
R1735 |
T3040 |
T3038 |
pobj |
terminus,against |
R1736 |
T3041 |
T3040 |
compound |
Acdp1,terminus |
R1737 |
T3042 |
T3040 |
compound |
C,terminus |
R1738 |
T3043 |
T3040 |
punct |
-,terminus |
R1739 |
T3044 |
T3032 |
punct |
", ",analyzed |
R174 |
T407 |
T399 |
punct |
),identity |
R1740 |
T3045 |
T3032 |
nsubj |
we,analyzed |
R1741 |
T3046 |
T3032 |
dobj |
extracts,analyzed |
R1742 |
T3047 |
T3046 |
prep |
of,extracts |
R1743 |
T3048 |
T3049 |
nmod |
HEK293,cells |
R1744 |
T3049 |
T3047 |
pobj |
cells,of |
R1745 |
T3050 |
T3048 |
punct |
", ",HEK293 |
R1746 |
T3051 |
T3048 |
conj |
3T3,HEK293 |
R1747 |
T3052 |
T3051 |
cc |
and,3T3 |
R1748 |
T3053 |
T3051 |
conj |
PC12,3T3 |
R1749 |
T3054 |
T3032 |
punct |
.,analyzed |
R175 |
T408 |
T395 |
punct |
", ",protein |
R1750 |
T3056 |
T3057 |
det |
The,results |
R1751 |
T3057 |
T3058 |
nsubjpass |
results,shown |
R1752 |
T3059 |
T3058 |
auxpass |
are,shown |
R1753 |
T3060 |
T3058 |
prep |
in,shown |
R1754 |
T3061 |
T3060 |
pobj |
Fig.,in |
R1755 |
T3062 |
T3061 |
nummod |
6B,Fig. |
R1756 |
T3063 |
T3058 |
punct |
.,shown |
R1757 |
T3065 |
T3066 |
advmod |
Apparently,detected |
R1758 |
T3067 |
T3066 |
punct |
", ",detected |
R1759 |
T3068 |
T3069 |
det |
this,antibody |
R176 |
T409 |
T410 |
dep |
which,involved |
R1760 |
T3069 |
T3066 |
nsubj |
antibody,detected |
R1761 |
T3070 |
T3071 |
det |
a,band |
R1762 |
T3071 |
T3066 |
dobj |
band,detected |
R1763 |
T3072 |
T3071 |
amod |
specific,band |
R1764 |
T3073 |
T3071 |
prep |
of,band |
R1765 |
T3074 |
T3073 |
pobj |
Acdp1,of |
R1766 |
T3075 |
T3066 |
prep |
in,detected |
R1767 |
T3076 |
T3077 |
det |
all,lysates |
R1768 |
T3077 |
T3075 |
pobj |
lysates,in |
R1769 |
T3078 |
T3077 |
compound |
cell,lysates |
R177 |
T410 |
T395 |
relcl |
involved,protein |
R1770 |
T3079 |
T3066 |
punct |
.,detected |
R1771 |
T3081 |
T3082 |
prep |
Of,are |
R1772 |
T3083 |
T3081 |
pobj |
note,Of |
R1773 |
T3084 |
T3082 |
punct |
", ",are |
R1774 |
T3085 |
T3082 |
dep |
shown,are |
R1775 |
T3086 |
T3085 |
prep |
in,shown |
R1776 |
T3087 |
T3086 |
pobj |
Fig.,in |
R1777 |
T3088 |
T3087 |
nummod |
6B,Fig. |
R1778 |
T3089 |
T3082 |
nsubj |
signals,are |
R1779 |
T3090 |
T3089 |
prep |
of,signals |
R178 |
T411 |
T410 |
auxpass |
is,involved |
R1780 |
T3091 |
T3092 |
nummod |
10,μg |
R1781 |
T3092 |
T3093 |
compound |
μg,extracts |
R1782 |
T3093 |
T3090 |
pobj |
extracts,of |
R1783 |
T3094 |
T3093 |
prep |
of,extracts |
R1784 |
T3095 |
T3096 |
compound |
HEK293,lysates |
R1785 |
T3096 |
T3094 |
pobj |
lysates,of |
R1786 |
T3097 |
T3096 |
compound |
cell,lysates |
R1787 |
T3098 |
T3093 |
punct |
", ",extracts |
R1788 |
T3099 |
T3100 |
nummod |
100,μg |
R1789 |
T3100 |
T3101 |
compound |
μg,extracts |
R179 |
T412 |
T410 |
prep |
in,involved |
R1790 |
T3101 |
T3093 |
appos |
extracts,extracts |
R1791 |
T3102 |
T3101 |
prep |
of,extracts |
R1792 |
T3103 |
T3104 |
nmod |
3T3,lysates |
R1793 |
T3104 |
T3102 |
pobj |
lysates,of |
R1794 |
T3105 |
T3103 |
cc |
and,3T3 |
R1795 |
T3106 |
T3103 |
conj |
PC12,3T3 |
R1796 |
T3107 |
T3104 |
compound |
cell,lysates |
R1797 |
T3108 |
T3082 |
punct |
.,are |
R1798 |
T3110 |
T3111 |
advmod |
Thus,vary |
R1799 |
T3112 |
T3111 |
punct |
", ",vary |
R18 |
T239 |
T238 |
amod |
novel,family |
R180 |
T413 |
T414 |
nmod |
magnesium,efflux |
R1800 |
T3113 |
T3114 |
det |
the,levels |
R1801 |
T3114 |
T3111 |
nsubj |
levels,vary |
R1802 |
T3115 |
T3114 |
compound |
expression,levels |
R1803 |
T3116 |
T3114 |
prep |
of,levels |
R1804 |
T3117 |
T3116 |
pobj |
Acdp1,of |
R1805 |
T3118 |
T3114 |
prep |
in,levels |
R1806 |
T3119 |
T3120 |
det |
these,types |
R1807 |
T3120 |
T3118 |
pobj |
types,in |
R1808 |
T3121 |
T3120 |
compound |
cell,types |
R1809 |
T3122 |
T3123 |
det |
a,lot |
R181 |
T414 |
T412 |
pobj |
efflux,in |
R1810 |
T3123 |
T3111 |
dobj |
lot,vary |
R1811 |
T3124 |
T3111 |
punct |
", ",vary |
R1812 |
T3125 |
T3111 |
prep |
with,vary |
R1813 |
T3126 |
T3127 |
det |
the,expression |
R1814 |
T3127 |
T3125 |
pobj |
expression,with |
R1815 |
T3128 |
T3127 |
amod |
highest,expression |
R1816 |
T3129 |
T3127 |
prep |
in,expression |
R1817 |
T3130 |
T3131 |
compound |
HEK293,cells |
R1818 |
T3131 |
T3129 |
pobj |
cells,in |
R1819 |
T3132 |
T3111 |
punct |
.,vary |
R182 |
T415 |
T413 |
cc |
and,magnesium |
R1820 |
T3134 |
T3135 |
advmod |
Nevertheless,support |
R1821 |
T3136 |
T3135 |
punct |
", ",support |
R1822 |
T3137 |
T3138 |
det |
these,results |
R1823 |
T3138 |
T3135 |
nsubj |
results,support |
R1824 |
T3139 |
T3138 |
compound |
immunoblot,results |
R1825 |
T3140 |
T3141 |
poss |
our,analysis |
R1826 |
T3141 |
T3135 |
dobj |
analysis,support |
R1827 |
T3142 |
T3141 |
prep |
of,analysis |
R1828 |
T3143 |
T3144 |
compound |
brain,extracts |
R1829 |
T3144 |
T3142 |
pobj |
extracts,of |
R183 |
T416 |
T413 |
conj |
cobalt,magnesium |
R1830 |
T3145 |
T3144 |
compound |
tissue,extracts |
R1831 |
T3146 |
T3147 |
mark |
that,recognizes |
R1832 |
T3147 |
T3141 |
acl |
recognizes,analysis |
R1833 |
T3148 |
T3149 |
det |
the,antibody |
R1834 |
T3149 |
T3147 |
nsubj |
antibody,recognizes |
R1835 |
T3150 |
T3149 |
prep |
against,antibody |
R1836 |
T3151 |
T3152 |
compound |
Acdp1,terminus |
R1837 |
T3152 |
T3150 |
pobj |
terminus,against |
R1838 |
T3153 |
T3152 |
compound |
C,terminus |
R1839 |
T3154 |
T3152 |
punct |
-,terminus |
R184 |
T417 |
T385 |
punct |
.,showed |
R1840 |
T3155 |
T3147 |
advmod |
specifically,recognizes |
R1841 |
T3156 |
T3147 |
dobj |
Acdp,recognizes |
R1842 |
T3157 |
T3156 |
punct |
-,Acdp |
R1843 |
T3158 |
T3156 |
nummod |
1,Acdp |
R1844 |
T3159 |
T3135 |
punct |
.,support |
R1845 |
T3161 |
T3162 |
det |
The,specificity |
R1846 |
T3162 |
T3163 |
nsubj |
specificity,suggests |
R1847 |
T3164 |
T3162 |
prep |
of,specificity |
R1848 |
T3165 |
T3166 |
det |
the,antibody |
R1849 |
T3166 |
T3164 |
pobj |
antibody,of |
R185 |
T419 |
T420 |
det |
The,genes |
R1850 |
T3167 |
T3166 |
compound |
Acdp1,antibody |
R1851 |
T3168 |
T3169 |
compound |
C,terminus |
R1852 |
T3169 |
T3166 |
compound |
terminus,antibody |
R1853 |
T3170 |
T3169 |
punct |
-,terminus |
R1854 |
T3171 |
T3172 |
det |
the,possibility |
R1855 |
T3172 |
T3163 |
dobj |
possibility,suggests |
R1856 |
T3173 |
T3172 |
prep |
of,possibility |
R1857 |
T3174 |
T3173 |
pcomp |
using,of |
R1858 |
T3175 |
T3174 |
dobj |
it,using |
R1859 |
T3176 |
T3177 |
aux |
to,localize |
R186 |
T420 |
T422 |
nsubjpass |
genes,expressed |
R1860 |
T3177 |
T3174 |
advcl |
localize,using |
R1861 |
T3178 |
T3177 |
dobj |
Acdp,localize |
R1862 |
T3179 |
T3178 |
punct |
-,Acdp |
R1863 |
T3180 |
T3178 |
nummod |
1,Acdp |
R1864 |
T3181 |
T3177 |
prep |
within,localize |
R1865 |
T3182 |
T3181 |
pobj |
cells,within |
R1866 |
T3183 |
T3163 |
punct |
.,suggests |
R1867 |
T3185 |
T3186 |
mark |
Since,revealed |
R1868 |
T3186 |
T3189 |
advcl |
revealed,examined |
R1869 |
T3187 |
T3188 |
compound |
Northern,blot |
R187 |
T421 |
T420 |
compound |
Acdp,genes |
R1870 |
T3188 |
T3186 |
nsubj |
blot,revealed |
R1871 |
T3190 |
T3191 |
advmod |
almost,exclusive |
R1872 |
T3191 |
T3192 |
amod |
exclusive,expression |
R1873 |
T3192 |
T3186 |
dobj |
expression,revealed |
R1874 |
T3193 |
T3192 |
prep |
of,expression |
R1875 |
T3194 |
T3193 |
pobj |
Acdp1,of |
R1876 |
T3195 |
T3186 |
prep |
in,revealed |
R1877 |
T3196 |
T3197 |
det |
the,brain |
R1878 |
T3197 |
T3195 |
pobj |
brain,in |
R1879 |
T3198 |
T3189 |
punct |
", ",examined |
R188 |
T423 |
T422 |
auxpass |
are,expressed |
R1880 |
T3199 |
T3189 |
nsubj |
we,examined |
R1881 |
T3200 |
T3201 |
poss |
its,localization |
R1882 |
T3201 |
T3189 |
dobj |
localization,examined |
R1883 |
T3202 |
T3201 |
amod |
subcellular,localization |
R1884 |
T3203 |
T3189 |
prep |
in,examined |
R1885 |
T3204 |
T3205 |
compound |
hippocampus,neurons |
R1886 |
T3205 |
T3203 |
pobj |
neurons,in |
R1887 |
T3206 |
T3205 |
acl |
isolated,neurons |
R1888 |
T3207 |
T3206 |
prep |
from,isolated |
R1889 |
T3208 |
T3209 |
compound |
mouse,embryos |
R189 |
T424 |
T422 |
advmod |
widely,expressed |
R1890 |
T3209 |
T3207 |
pobj |
embryos,from |
R1891 |
T3210 |
T3189 |
punct |
.,examined |
R1892 |
T3212 |
T3213 |
det |
The,neurons |
R1893 |
T3213 |
T3214 |
nsubjpass |
neurons,cultured |
R1894 |
T3215 |
T3214 |
auxpass |
were,cultured |
R1895 |
T3216 |
T3214 |
prep |
on,cultured |
R1896 |
T3217 |
T3218 |
compound |
glass,coverslips |
R1897 |
T3218 |
T3216 |
pobj |
coverslips,on |
R1898 |
T3219 |
T3218 |
acl |
coated,coverslips |
R1899 |
T3220 |
T3219 |
prep |
with,coated |
R19 |
T240 |
T238 |
compound |
gene,family |
R190 |
T425 |
T422 |
prep |
in,expressed |
R1900 |
T3221 |
T3222 |
det |
a,monolayer |
R1901 |
T3222 |
T3220 |
pobj |
monolayer,with |
R1902 |
T3223 |
T3222 |
amod |
confluent,monolayer |
R1903 |
T3224 |
T3222 |
prep |
of,monolayer |
R1904 |
T3225 |
T3226 |
nmod |
mouse,astrocytes |
R1905 |
T3226 |
T3224 |
pobj |
astrocytes,of |
R1906 |
T3227 |
T3226 |
amod |
cortical,astrocytes |
R1907 |
T3228 |
T3214 |
prep |
in,cultured |
R1908 |
T3229 |
T3228 |
pobj |
dishes,in |
R1909 |
T3230 |
T3214 |
punct |
.,cultured |
R191 |
T426 |
T427 |
det |
all,tissues |
R1910 |
T3232 |
T3233 |
nsubj |
Immunostaining,using |
R1911 |
T3234 |
T3233 |
aux |
was,using |
R1912 |
T3235 |
T3236 |
det |
the,antibody |
R1913 |
T3236 |
T3233 |
dobj |
antibody,using |
R1914 |
T3237 |
T3236 |
nmod |
Acdp1,antibody |
R1915 |
T3238 |
T3239 |
compound |
C,terminus |
R1916 |
T3239 |
T3241 |
npadvmod |
terminus,specific |
R1917 |
T3240 |
T3239 |
punct |
-,terminus |
R1918 |
T3241 |
T3236 |
amod |
specific,antibody |
R1919 |
T3242 |
T3233 |
punct |
.,using |
R192 |
T427 |
T425 |
pobj |
tissues,in |
R1920 |
T3244 |
T3245 |
amod |
Confocal,imaging |
R1921 |
T3245 |
T3246 |
nsubj |
imaging,revealed |
R1922 |
T3247 |
T3248 |
mark |
that,localized |
R1923 |
T3248 |
T3246 |
ccomp |
localized,revealed |
R1924 |
T3249 |
T3248 |
nsubjpass |
Acdp1,localized |
R1925 |
T3250 |
T3248 |
auxpass |
is,localized |
R1926 |
T3251 |
T3248 |
advmod |
predominantly,localized |
R1927 |
T3252 |
T3248 |
prep |
on,localized |
R1928 |
T3253 |
T3254 |
det |
the,membrane |
R1929 |
T3254 |
T3252 |
pobj |
membrane,on |
R193 |
T428 |
T427 |
acl |
tested,tissues |
R1930 |
T3255 |
T3254 |
compound |
plasma,membrane |
R1931 |
T3256 |
T3246 |
punct |
.,revealed |
R1932 |
T3258 |
T3259 |
det |
A,series |
R1933 |
T3259 |
T3260 |
nsubj |
series,showed |
R1934 |
T3261 |
T3259 |
prep |
of,series |
R1935 |
T3262 |
T3261 |
pobj |
sections,of |
R1936 |
T3263 |
T3262 |
prep |
of,sections |
R1937 |
T3264 |
T3265 |
det |
a,cell |
R1938 |
T3265 |
T3263 |
pobj |
cell,of |
R1939 |
T3266 |
T3259 |
prep |
at,series |
R194 |
T429 |
T422 |
prep |
except,expressed |
R1940 |
T3267 |
T3268 |
det |
the,thickness |
R1941 |
T3268 |
T3266 |
pobj |
thickness,at |
R1942 |
T3269 |
T3268 |
prep |
of,thickness |
R1943 |
T3270 |
T3271 |
nummod |
0.5,micrometer |
R1944 |
T3271 |
T3269 |
pobj |
micrometer,of |
R1945 |
T3272 |
T3260 |
advmod |
clearly,showed |
R1946 |
T3273 |
T3274 |
compound |
membrane,location |
R1947 |
T3274 |
T3260 |
dobj |
location,showed |
R1948 |
T3275 |
T3274 |
prep |
of,location |
R1949 |
T3276 |
T3277 |
compound |
Acdp1,immunoreactivity |
R195 |
T430 |
T429 |
prep |
for,except |
R1950 |
T3277 |
T3275 |
pobj |
immunoreactivity,of |
R1951 |
T3278 |
T3277 |
punct |
-,immunoreactivity |
R1952 |
T3279 |
T3280 |
punct |
(,Fig. |
R1953 |
T3280 |
T3277 |
parataxis |
Fig.,immunoreactivity |
R1954 |
T3281 |
T3280 |
nummod |
7,Fig. |
R1955 |
T3282 |
T3280 |
punct |
),Fig. |
R1956 |
T3283 |
T3260 |
punct |
", ",showed |
R1957 |
T3284 |
T3285 |
dep |
which,is |
R1958 |
T3285 |
T3260 |
advcl |
is,showed |
R1959 |
T3286 |
T3285 |
acomp |
consistent,is |
R196 |
T431 |
T430 |
pobj |
Acdp1,for |
R1960 |
T3287 |
T3286 |
prep |
with,consistent |
R1961 |
T3288 |
T3289 |
det |
the,observation |
R1962 |
T3289 |
T3287 |
pobj |
observation,with |
R1963 |
T3290 |
T3289 |
prep |
of,observation |
R1964 |
T3291 |
T3292 |
compound |
transmembrane,domains |
R1965 |
T3292 |
T3290 |
pobj |
domains,of |
R1966 |
T3293 |
T3289 |
prep |
within,observation |
R1967 |
T3294 |
T3295 |
det |
the,proteins |
R1968 |
T3295 |
T3293 |
pobj |
proteins,within |
R1969 |
T3296 |
T3295 |
compound |
Acdp,proteins |
R197 |
T432 |
T431 |
punct |
", ",Acdp1 |
R1970 |
T3297 |
T3260 |
punct |
.,showed |
R1973 |
T3529 |
T3530 |
mark |
Although,elucidated |
R1974 |
T3530 |
T3542 |
advcl |
elucidated,suggest |
R1975 |
T3531 |
T3532 |
det |
the,functions |
R1976 |
T3532 |
T3530 |
nsubjpass |
functions,elucidated |
R1977 |
T3533 |
T3532 |
amod |
exact,functions |
R1978 |
T3534 |
T3532 |
prep |
of,functions |
R1979 |
T3535 |
T3536 |
det |
the,family |
R198 |
T433 |
T434 |
dep |
which,expressed |
R1980 |
T3536 |
T3534 |
pobj |
family,of |
R1981 |
T3537 |
T3536 |
compound |
ACDP,family |
R1982 |
T3538 |
T3536 |
compound |
gene,family |
R1983 |
T3539 |
T3530 |
auxpass |
are,elucidated |
R1984 |
T3540 |
T3530 |
neg |
not,elucidated |
R1985 |
T3541 |
T3530 |
advmod |
yet,elucidated |
R1986 |
T3543 |
T3542 |
punct |
", ",suggest |
R1987 |
T3544 |
T3545 |
amod |
several,lines |
R1988 |
T3545 |
T3542 |
nsubj |
lines,suggest |
R1989 |
T3546 |
T3545 |
prep |
of,lines |
R199 |
T434 |
T431 |
relcl |
expressed,Acdp1 |
R1990 |
T3547 |
T3546 |
pobj |
evidence,of |
R1991 |
T3548 |
T3549 |
mark |
that,play |
R1992 |
T3549 |
T3542 |
ccomp |
play,suggest |
R1993 |
T3550 |
T3551 |
compound |
ACDP,genes |
R1994 |
T3551 |
T3549 |
nsubj |
genes,play |
R1995 |
T3552 |
T3549 |
aux |
may,play |
R1996 |
T3553 |
T3554 |
det |
an,role |
R1997 |
T3554 |
T3549 |
dobj |
role,play |
R1998 |
T3555 |
T3554 |
amod |
important,role |
R1999 |
T3556 |
T3549 |
prep |
in,play |
R20 |
T241 |
T238 |
acl |
named,family |
R200 |
T435 |
T434 |
auxpass |
is,expressed |
R2000 |
T3557 |
T3558 |
amod |
biological,processes |
R2001 |
T3558 |
T3556 |
pobj |
processes,in |
R2002 |
T3559 |
T3542 |
punct |
.,suggest |
R2003 |
T3561 |
T3562 |
advmod |
First,conserved |
R2004 |
T3562 |
T3568 |
ccomp |
conserved,expressed |
R2005 |
T3563 |
T3562 |
punct |
", ",conserved |
R2006 |
T3564 |
T3565 |
det |
these,genes |
R2007 |
T3565 |
T3562 |
nsubjpass |
genes,conserved |
R2008 |
T3566 |
T3562 |
auxpass |
are,conserved |
R2009 |
T3567 |
T3562 |
advmod |
evolutionarily,conserved |
R201 |
T436 |
T434 |
advmod |
only,expressed |
R2010 |
T3569 |
T3562 |
prep |
in,conserved |
R2011 |
T3570 |
T3571 |
amod |
many,species |
R2012 |
T3571 |
T3569 |
pobj |
species,in |
R2013 |
T3572 |
T3573 |
advmod |
phylogenetically,divergent |
R2014 |
T3573 |
T3571 |
amod |
divergent,species |
R2015 |
T3574 |
T3568 |
punct |
;,expressed |
R2016 |
T3575 |
T3576 |
advmod |
Second,are |
R2017 |
T3576 |
T3568 |
ccomp |
are,expressed |
R2018 |
T3577 |
T3576 |
punct |
", ",are |
R2019 |
T3578 |
T3579 |
amod |
multiple,genes |
R202 |
T437 |
T434 |
advmod |
highly,expressed |
R2020 |
T3579 |
T3576 |
nsubj |
genes,are |
R2021 |
T3580 |
T3576 |
acomp |
present,are |
R2022 |
T3581 |
T3576 |
prep |
in,are |
R2023 |
T3582 |
T3583 |
det |
a,species |
R2024 |
T3583 |
T3581 |
pobj |
species,in |
R2025 |
T3584 |
T3568 |
punct |
;,expressed |
R2026 |
T3585 |
T3568 |
advmod |
Third,expressed |
R2027 |
T3586 |
T3568 |
punct |
", ",expressed |
R2028 |
T3587 |
T3588 |
det |
these,genes |
R2029 |
T3588 |
T3568 |
nsubjpass |
genes,expressed |
R203 |
T438 |
T434 |
prep |
in,expressed |
R2030 |
T3589 |
T3568 |
auxpass |
are,expressed |
R2031 |
T3590 |
T3568 |
advmod |
ubiquitously,expressed |
R2032 |
T3591 |
T3568 |
prep |
throughout,expressed |
R2033 |
T3592 |
T3593 |
nmod |
development,tissues |
R2034 |
T3593 |
T3591 |
pobj |
tissues,throughout |
R2035 |
T3594 |
T3592 |
cc |
and,development |
R2036 |
T3595 |
T3592 |
conj |
adult,development |
R2037 |
T3596 |
T3597 |
punct |
(,data |
R2038 |
T3597 |
T3568 |
meta |
data,expressed |
R2039 |
T3598 |
T3597 |
amod |
unpublished,data |
R204 |
T439 |
T440 |
det |
the,brain |
R2040 |
T3599 |
T3597 |
punct |
),data |
R2041 |
T3600 |
T3568 |
punct |
.,expressed |
R2042 |
T3602 |
T3603 |
det |
The,cloning |
R2043 |
T3603 |
T3604 |
nsubj |
cloning,are |
R2044 |
T3605 |
T3603 |
cc |
and,cloning |
R2045 |
T3606 |
T3603 |
conj |
characterization,cloning |
R2046 |
T3607 |
T3603 |
prep |
of,cloning |
R2047 |
T3608 |
T3609 |
det |
the,family |
R2048 |
T3609 |
T3607 |
pobj |
family,of |
R2049 |
T3610 |
T3609 |
compound |
mouse,family |
R205 |
T440 |
T438 |
pobj |
brain,in |
R2050 |
T3611 |
T3609 |
compound |
Acdp,family |
R2051 |
T3612 |
T3609 |
compound |
gene,family |
R2052 |
T3613 |
T3614 |
det |
a,step |
R2053 |
T3614 |
T3604 |
attr |
step,are |
R2054 |
T3615 |
T3616 |
advmod |
very,important |
R2055 |
T3616 |
T3614 |
amod |
important,step |
R2056 |
T3617 |
T3614 |
prep |
towards,step |
R2057 |
T3618 |
T3619 |
det |
the,elucidation |
R2058 |
T3619 |
T3617 |
pobj |
elucidation,towards |
R2059 |
T3620 |
T3619 |
prep |
of,elucidation |
R206 |
T441 |
T442 |
mark |
with,levels |
R2060 |
T3621 |
T3622 |
det |
the,functions |
R2061 |
T3622 |
T3620 |
pobj |
functions,of |
R2062 |
T3623 |
T3622 |
prep |
of,functions |
R2063 |
T3624 |
T3625 |
det |
this,family |
R2064 |
T3625 |
T3623 |
pobj |
family,of |
R2065 |
T3626 |
T3625 |
amod |
multigene,family |
R2066 |
T3627 |
T3604 |
punct |
.,are |
R2067 |
T3629 |
T3630 |
compound |
Sequence,analyses |
R2068 |
T3630 |
T3632 |
nsubj |
analyses,revealed |
R2069 |
T3631 |
T3630 |
compound |
homology,analyses |
R207 |
T442 |
T434 |
advcl |
levels,expressed |
R2070 |
T3633 |
T3634 |
mark |
that,shared |
R2071 |
T3634 |
T3632 |
ccomp |
shared,revealed |
R2072 |
T3635 |
T3636 |
compound |
Acdp,proteins |
R2073 |
T3636 |
T3634 |
nsubj |
proteins,shared |
R2074 |
T3637 |
T3638 |
advmod |
very,strong |
R2075 |
T3638 |
T3639 |
amod |
strong,homologies |
R2076 |
T3639 |
T3634 |
dobj |
homologies,shared |
R2077 |
T3640 |
T3639 |
compound |
AA,homologies |
R2078 |
T3641 |
T3639 |
prep |
to,homologies |
R2079 |
T3642 |
T3643 |
det |
the,protein |
R208 |
T443 |
T442 |
amod |
low,levels |
R2080 |
T3643 |
T3641 |
pobj |
protein,to |
R2081 |
T3644 |
T3643 |
compound |
bacteria,protein |
R2082 |
T3645 |
T3643 |
compound |
CorC,protein |
R2083 |
T3646 |
T3643 |
cc |
and,protein |
R2084 |
T3647 |
T3648 |
compound |
yeast,protein |
R2085 |
T3648 |
T3643 |
conj |
protein,protein |
R2086 |
T3649 |
T3648 |
compound |
Amip3,protein |
R2087 |
T3650 |
T3632 |
punct |
.,revealed |
R2088 |
T3652 |
T3653 |
nsubj |
CorA,belong |
R2089 |
T3654 |
T3652 |
punct |
", ",CorA |
R209 |
T444 |
T442 |
prep |
of,levels |
R2090 |
T3655 |
T3652 |
conj |
B,CorA |
R2091 |
T3656 |
T3655 |
punct |
", ",B |
R2092 |
T3657 |
T3655 |
conj |
C,B |
R2093 |
T3658 |
T3657 |
cc |
and,C |
R2094 |
T3659 |
T3657 |
conj |
D,C |
R2095 |
T3660 |
T3653 |
prep |
to,belong |
R2096 |
T3661 |
T3662 |
det |
a,family |
R2097 |
T3662 |
T3660 |
pobj |
family,to |
R2098 |
T3663 |
T3662 |
compound |
protein,family |
R2099 |
T3664 |
T3662 |
acl |
involved,family |
R21 |
T242 |
T243 |
amod |
ancient,protein |
R210 |
T445 |
T444 |
pobj |
expression,of |
R2100 |
T3665 |
T3664 |
prep |
in,involved |
R2101 |
T3666 |
T3667 |
preconj |
both,influx |
R2102 |
T3667 |
T3665 |
pobj |
influx,in |
R2103 |
T3668 |
T3667 |
cc |
and,influx |
R2104 |
T3669 |
T3667 |
conj |
efflux,influx |
R2105 |
T3670 |
T3667 |
prep |
of,influx |
R2106 |
T3671 |
T3670 |
pobj |
magnesium,of |
R2107 |
T3672 |
T3671 |
cc |
and,magnesium |
R2108 |
T3673 |
T3671 |
conj |
cobalt,magnesium |
R2109 |
T3674 |
T3653 |
punct |
.,belong |
R211 |
T446 |
T442 |
prep |
in,levels |
R2110 |
T3676 |
T3677 |
nsubjpass |
It,shown |
R2111 |
T3678 |
T3677 |
aux |
has,shown |
R2112 |
T3679 |
T3677 |
auxpass |
been,shown |
R2113 |
T3680 |
T3681 |
mark |
that,confer |
R2114 |
T3681 |
T3677 |
ccomp |
confer,shown |
R2115 |
T3682 |
T3683 |
compound |
CorA,mutants |
R2116 |
T3683 |
T3681 |
nsubj |
mutants,confer |
R2117 |
T3684 |
T3681 |
dobj |
resistance,confer |
R2118 |
T3685 |
T3684 |
prep |
to,resistance |
R2119 |
T3686 |
T3687 |
compound |
cobalt,toxicity |
R212 |
T447 |
T446 |
pobj |
kidney,in |
R2120 |
T3687 |
T3685 |
pobj |
toxicity,to |
R2121 |
T3688 |
T3689 |
punct |
[,9 |
R2122 |
T3689 |
T3677 |
parataxis |
9,shown |
R2123 |
T3690 |
T3689 |
punct |
],9 |
R2124 |
T3691 |
T3677 |
punct |
.,shown |
R2125 |
T3693 |
T3694 |
nsubj |
Amip3,appears |
R2126 |
T3695 |
T3696 |
aux |
to,be |
R2127 |
T3696 |
T3694 |
xcomp |
be,appears |
R2128 |
T3697 |
T3698 |
det |
a,homologous |
R2129 |
T3698 |
T3696 |
attr |
homologous,be |
R213 |
T448 |
T447 |
cc |
and,kidney |
R2130 |
T3699 |
T3698 |
prep |
to,homologous |
R2131 |
T3700 |
T3701 |
compound |
CorC,protein |
R2132 |
T3701 |
T3699 |
pobj |
protein,to |
R2133 |
T3702 |
T3703 |
dep |
which,involved |
R2134 |
T3703 |
T3701 |
relcl |
involved,protein |
R2135 |
T3704 |
T3703 |
auxpass |
is,involved |
R2136 |
T3705 |
T3703 |
prep |
in,involved |
R2137 |
T3706 |
T3705 |
pobj |
efflux,in |
R2138 |
T3707 |
T3706 |
prep |
of,efflux |
R2139 |
T3708 |
T3707 |
pobj |
magnesium,of |
R214 |
T449 |
T447 |
conj |
testis,kidney |
R2140 |
T3709 |
T3708 |
cc |
and,magnesium |
R2141 |
T3710 |
T3708 |
conj |
cobalt,magnesium |
R2142 |
T3711 |
T3703 |
prep |
in,involved |
R2143 |
T3712 |
T3711 |
pobj |
bacteria,in |
R2144 |
T3713 |
T3694 |
punct |
.,appears |
R2145 |
T3715 |
T3716 |
compound |
Amip3,mutants |
R2146 |
T3716 |
T3717 |
nsubj |
mutants,confer |
R2147 |
T3718 |
T3717 |
dobj |
resistant,confer |
R2148 |
T3719 |
T3718 |
prep |
to,resistant |
R2149 |
T3720 |
T3721 |
compound |
copper,toxicity |
R215 |
T450 |
T422 |
punct |
.,expressed |
R2150 |
T3721 |
T3719 |
pobj |
toxicity,to |
R2151 |
T3722 |
T3717 |
punct |
.,confer |
R2152 |
T3724 |
T3725 |
nsubj |
Acdp,possess |
R2153 |
T3726 |
T3725 |
dep |
proteins,possess |
R2154 |
T3727 |
T3725 |
advmod |
also,possess |
R2155 |
T3728 |
T3729 |
det |
the,domains |
R2156 |
T3729 |
T3725 |
dobj |
domains,possess |
R2157 |
T3730 |
T3731 |
dep |
that,found |
R2158 |
T3731 |
T3729 |
relcl |
found,domains |
R2159 |
T3732 |
T3731 |
auxpass |
are,found |
R216 |
T452 |
T453 |
nsubj |
Immunostaining,revealed |
R2160 |
T3733 |
T3731 |
prep |
in,found |
R2161 |
T3734 |
T3735 |
nmod |
bacteria,CorC |
R2162 |
T3735 |
T3736 |
nmod |
CorC,proteins |
R2163 |
T3736 |
T3733 |
pobj |
proteins,in |
R2164 |
T3737 |
T3735 |
cc |
and,CorC |
R2165 |
T3738 |
T3739 |
compound |
yeast,Amip3 |
R2166 |
T3739 |
T3735 |
conj |
Amip3,CorC |
R2167 |
T3740 |
T3729 |
punct |
", ",domains |
R2168 |
T3741 |
T3742 |
amod |
such,as |
R2169 |
T3742 |
T3729 |
prep |
as,domains |
R217 |
T454 |
T452 |
prep |
of,Immunostaining |
R2170 |
T3743 |
T3744 |
det |
the,domains |
R2171 |
T3744 |
T3742 |
pobj |
domains,as |
R2172 |
T3745 |
T3744 |
compound |
CBS,domains |
R2173 |
T3746 |
T3744 |
punct |
", ",domains |
R2174 |
T3747 |
T3748 |
compound |
DUF21,domain |
R2175 |
T3748 |
T3744 |
conj |
domain,domains |
R2176 |
T3749 |
T3748 |
cc |
and,domain |
R2177 |
T3750 |
T3751 |
compound |
transmembrane,domains |
R2178 |
T3751 |
T3748 |
conj |
domains,domain |
R2179 |
T3752 |
T3725 |
punct |
.,possess |
R218 |
T455 |
T454 |
pobj |
Acdp1,of |
R2180 |
T3754 |
T3755 |
prep |
In,found |
R2181 |
T3756 |
T3754 |
pobj |
addition,In |
R2182 |
T3757 |
T3755 |
punct |
", ",found |
R2183 |
T3758 |
T3759 |
det |
a,domain |
R2184 |
T3759 |
T3755 |
nsubjpass |
domain,found |
R2185 |
T3760 |
T3761 |
npadvmod |
cNMP,binding |
R2186 |
T3761 |
T3759 |
amod |
binding,domain |
R2187 |
T3762 |
T3761 |
punct |
-,binding |
R2188 |
T3763 |
T3755 |
auxpass |
was,found |
R2189 |
T3764 |
T3755 |
prep |
in,found |
R219 |
T456 |
T455 |
prep |
in,Acdp1 |
R2190 |
T3765 |
T3766 |
det |
all,proteins |
R2191 |
T3766 |
T3764 |
pobj |
proteins,in |
R2192 |
T3767 |
T3766 |
compound |
Acdp,proteins |
R2193 |
T3768 |
T3755 |
punct |
", ",found |
R2194 |
T3769 |
T3770 |
dep |
which,is |
R2195 |
T3770 |
T3755 |
ccomp |
is,found |
R2196 |
T3771 |
T3770 |
advmod |
usually,is |
R2197 |
T3772 |
T3770 |
acomp |
present,is |
R2198 |
T3773 |
T3770 |
prep |
in,is |
R2199 |
T3774 |
T3775 |
compound |
ion,channels |
R22 |
T243 |
T241 |
oprd |
protein,named |
R220 |
T457 |
T458 |
compound |
hippocampus,neurons |
R2200 |
T3775 |
T3773 |
pobj |
channels,in |
R2201 |
T3776 |
T3775 |
cc |
and,channels |
R2202 |
T3777 |
T3778 |
nmod |
cNMP,kinases |
R2203 |
T3778 |
T3775 |
conj |
kinases,channels |
R2204 |
T3779 |
T3777 |
punct |
-,cNMP |
R2205 |
T3780 |
T3777 |
amod |
dependent,cNMP |
R2206 |
T3781 |
T3782 |
punct |
[,10 |
R2207 |
T3782 |
T3755 |
parataxis |
10,found |
R2208 |
T3783 |
T3784 |
punct |
-,13 |
R2209 |
T3784 |
T3782 |
prep |
13,10 |
R221 |
T458 |
T456 |
pobj |
neurons,in |
R2210 |
T3785 |
T3782 |
punct |
],10 |
R2211 |
T3786 |
T3755 |
punct |
.,found |
R2212 |
T3788 |
T3789 |
advcl |
Using,shown |
R2213 |
T3790 |
T3788 |
dobj |
antibody,Using |
R2214 |
T3791 |
T3790 |
acl |
produced,antibody |
R2215 |
T3792 |
T3791 |
agent |
by,produced |
R2216 |
T3793 |
T3794 |
nmod |
Acdp1,peptide |
R2217 |
T3794 |
T3792 |
pobj |
peptide,by |
R2218 |
T3795 |
T3796 |
npadvmod |
C,terminal |
R2219 |
T3796 |
T3794 |
amod |
terminal,peptide |
R222 |
T459 |
T460 |
det |
a,localization |
R2220 |
T3797 |
T3796 |
punct |
-,terminal |
R2221 |
T3798 |
T3789 |
punct |
", ",shown |
R2222 |
T3799 |
T3789 |
nsubj |
we,shown |
R2223 |
T3800 |
T3789 |
aux |
have,shown |
R2224 |
T3801 |
T3802 |
mark |
that,localized |
R2225 |
T3802 |
T3789 |
ccomp |
localized,shown |
R2226 |
T3803 |
T3802 |
nsubjpass |
Acdp1,localized |
R2227 |
T3804 |
T3802 |
auxpass |
is,localized |
R2228 |
T3805 |
T3802 |
advmod |
predominantly,localized |
R2229 |
T3806 |
T3802 |
prep |
on,localized |
R223 |
T460 |
T453 |
dobj |
localization,revealed |
R2230 |
T3807 |
T3808 |
det |
the,membrane |
R2231 |
T3808 |
T3806 |
pobj |
membrane,on |
R2232 |
T3809 |
T3808 |
compound |
plasma,membrane |
R2233 |
T3810 |
T3802 |
prep |
in,localized |
R2234 |
T3811 |
T3812 |
compound |
hippocampus,neurons |
R2235 |
T3812 |
T3810 |
pobj |
neurons,in |
R2236 |
T3813 |
T3789 |
punct |
.,shown |
R2237 |
T3815 |
T3816 |
prep |
In,found |
R2238 |
T3817 |
T3818 |
poss |
our,study |
R2239 |
T3818 |
T3815 |
pobj |
study,In |
R224 |
T461 |
T460 |
amod |
predominant,localization |
R2240 |
T3819 |
T3818 |
amod |
previous,study |
R2241 |
T3820 |
T3816 |
punct |
", ",found |
R2242 |
T3821 |
T3816 |
nsubj |
we,found |
R2243 |
T3822 |
T3823 |
amod |
human,proteins |
R2244 |
T3823 |
T3825 |
nsubjpass |
proteins,localized |
R2245 |
T3824 |
T3823 |
compound |
ACDP,proteins |
R2246 |
T3825 |
T3816 |
advcl |
localized,found |
R2247 |
T3826 |
T3825 |
auxpass |
are,localized |
R2248 |
T3827 |
T3825 |
advmod |
predominantly,localized |
R2249 |
T3828 |
T3825 |
prep |
in,localized |
R225 |
T462 |
T453 |
prep |
on,revealed |
R2250 |
T3829 |
T3830 |
det |
the,nucleus |
R2251 |
T3830 |
T3828 |
pobj |
nucleus,in |
R2252 |
T3831 |
T3825 |
prep |
in,localized |
R2253 |
T3832 |
T3833 |
compound |
HeLa,cells |
R2254 |
T3833 |
T3831 |
pobj |
cells,in |
R2255 |
T3834 |
T3835 |
punct |
[,1 |
R2256 |
T3835 |
T3816 |
parataxis |
1,found |
R2257 |
T3836 |
T3835 |
punct |
],1 |
R2258 |
T3837 |
T3816 |
punct |
.,found |
R2259 |
T3839 |
T3840 |
det |
The,discrepancy |
R226 |
T463 |
T464 |
det |
the,membrane |
R2260 |
T3840 |
T3841 |
nsubjpass |
discrepancy,caused |
R2261 |
T3842 |
T3840 |
prep |
for,discrepancy |
R2262 |
T3843 |
T3844 |
compound |
Acdp,localization |
R2263 |
T3844 |
T3842 |
pobj |
localization,for |
R2264 |
T3845 |
T3844 |
prep |
in,localization |
R2265 |
T3846 |
T3847 |
amod |
neuronal,cells |
R2266 |
T3847 |
T3845 |
pobj |
cells,in |
R2267 |
T3848 |
T3841 |
aux |
could,caused |
R2268 |
T3849 |
T3841 |
auxpass |
be,caused |
R2269 |
T3850 |
T3841 |
agent |
by,caused |
R227 |
T464 |
T462 |
pobj |
membrane,on |
R2270 |
T3851 |
T3850 |
pobj |
non-specificity,by |
R2271 |
T3852 |
T3851 |
prep |
for,non-specificity |
R2272 |
T3853 |
T3854 |
amod |
previous,antibody |
R2273 |
T3854 |
T3852 |
pobj |
antibody,for |
R2274 |
T3855 |
T3856 |
dep |
which,produced |
R2275 |
T3856 |
T3854 |
relcl |
produced,antibody |
R2276 |
T3857 |
T3856 |
auxpass |
was,produced |
R2277 |
T3858 |
T3856 |
prep |
by,produced |
R2278 |
T3859 |
T3860 |
det |
the,domain |
R2279 |
T3860 |
T3858 |
pobj |
domain,by |
R228 |
T465 |
T464 |
compound |
plasma,membrane |
R2280 |
T3861 |
T3860 |
amod |
recombinant,domain |
R2281 |
T3862 |
T3860 |
compound |
ACD,domain |
R2282 |
T3863 |
T3851 |
punct |
", ",non-specificity |
R2283 |
T3864 |
T3851 |
cc |
or,non-specificity |
R2284 |
T3865 |
T3866 |
amod |
different,cells |
R2285 |
T3866 |
T3851 |
conj |
cells,non-specificity |
R2286 |
T3867 |
T3866 |
acl |
used,cells |
R2287 |
T3868 |
T3841 |
punct |
.,caused |
R2288 |
T3870 |
T3871 |
prep |
In,recognizes |
R2289 |
T3872 |
T3873 |
amod |
current,study |
R229 |
T466 |
T453 |
punct |
.,revealed |
R2290 |
T3873 |
T3870 |
pobj |
study,In |
R2291 |
T3874 |
T3871 |
punct |
", ",recognizes |
R2292 |
T3875 |
T3876 |
det |
the,antibody |
R2293 |
T3876 |
T3871 |
nsubj |
antibody,recognizes |
R2294 |
T3877 |
T3876 |
compound |
Acdp1,antibody |
R2295 |
T3878 |
T3879 |
compound |
C,terminus |
R2296 |
T3879 |
T3876 |
compound |
terminus,antibody |
R2297 |
T3880 |
T3879 |
punct |
-,terminus |
R2298 |
T3881 |
T3871 |
advmod |
only,recognizes |
R2299 |
T3882 |
T3871 |
dobj |
Acdp1,recognizes |
R23 |
T244 |
T243 |
amod |
conserved,protein |
R230 |
T470 |
T471 |
det |
The,genes |
R2300 |
T3883 |
T3871 |
prep |
in,recognizes |
R2301 |
T3884 |
T3885 |
compound |
brain,tissue |
R2302 |
T3885 |
T3886 |
compound |
tissue,extracts |
R2303 |
T3886 |
T3883 |
pobj |
extracts,in |
R2304 |
T3887 |
T3888 |
advmod |
as,as |
R2305 |
T3888 |
T3883 |
cc |
as,in |
R2306 |
T3889 |
T3888 |
advmod |
well,as |
R2307 |
T3890 |
T3883 |
conj |
in,in |
R2308 |
T3891 |
T3892 |
nmod |
HEK293,lysates |
R2309 |
T3892 |
T3890 |
pobj |
lysates,in |
R231 |
T471 |
T473 |
nsubjpass |
genes,conserved |
R2310 |
T3893 |
T3891 |
punct |
", ",HEK293 |
R2311 |
T3894 |
T3891 |
conj |
3T3,HEK293 |
R2312 |
T3895 |
T3894 |
cc |
and,3T3 |
R2313 |
T3896 |
T3894 |
conj |
PC12,3T3 |
R2314 |
T3897 |
T3892 |
compound |
cell,lysates |
R2315 |
T3898 |
T3871 |
punct |
", ",recognizes |
R2316 |
T3899 |
T3871 |
advcl |
suggesting,recognizes |
R2317 |
T3900 |
T3901 |
det |
the,specificity |
R2318 |
T3901 |
T3899 |
dobj |
specificity,suggesting |
R2319 |
T3902 |
T3901 |
prep |
of,specificity |
R232 |
T472 |
T471 |
compound |
Acdp,genes |
R2320 |
T3903 |
T3904 |
det |
the,antibody |
R2321 |
T3904 |
T3902 |
pobj |
antibody,of |
R2322 |
T3905 |
T3871 |
punct |
.,recognizes |
R2323 |
T3907 |
T3908 |
poss |
Our,observations |
R2324 |
T3908 |
T3909 |
nsubj |
observations,suggested |
R2325 |
T3910 |
T3911 |
mark |
that,involved |
R2326 |
T3911 |
T3909 |
ccomp |
involved,suggested |
R2327 |
T3912 |
T3911 |
nsubjpass |
Acdp,involved |
R2328 |
T3913 |
T3911 |
aux |
might,involved |
R2329 |
T3914 |
T3911 |
auxpass |
be,involved |
R233 |
T474 |
T473 |
auxpass |
are,conserved |
R2330 |
T3915 |
T3911 |
prep |
in,involved |
R2331 |
T3916 |
T3917 |
compound |
ion,transport |
R2332 |
T3917 |
T3915 |
pobj |
transport,in |
R2333 |
T3918 |
T3911 |
prep |
in,involved |
R2334 |
T3919 |
T3920 |
amod |
mammalian,cells |
R2335 |
T3920 |
T3918 |
pobj |
cells,in |
R2336 |
T3921 |
T3909 |
punct |
.,suggested |
R2337 |
T3923 |
T3924 |
advmod |
However,needed |
R2338 |
T3925 |
T3924 |
punct |
", ",needed |
R2339 |
T3926 |
T3927 |
advmod |
more,detailed |
R234 |
T475 |
T473 |
advmod |
evolutionarily,conserved |
R2340 |
T3927 |
T3928 |
amod |
detailed,studies |
R2341 |
T3928 |
T3924 |
nsubjpass |
studies,needed |
R2342 |
T3929 |
T3928 |
amod |
functional,studies |
R2343 |
T3930 |
T3924 |
auxpass |
are,needed |
R2344 |
T3931 |
T3932 |
aux |
to,demonstrate |
R2345 |
T3932 |
T3924 |
advcl |
demonstrate,needed |
R2346 |
T3933 |
T3934 |
det |
the,functions |
R2347 |
T3934 |
T3932 |
dobj |
functions,demonstrate |
R2348 |
T3935 |
T3934 |
amod |
real,functions |
R2349 |
T3936 |
T3934 |
prep |
of,functions |
R235 |
T476 |
T473 |
prep |
in,conserved |
R2350 |
T3937 |
T3938 |
det |
these,proteins |
R2351 |
T3938 |
T3936 |
pobj |
proteins,of |
R2352 |
T3939 |
T3924 |
punct |
.,needed |
R2353 |
T4051 |
T4052 |
poss |
Our,work |
R2354 |
T4052 |
T4054 |
nsubj |
work,described |
R2355 |
T4053 |
T4052 |
amod |
previous,work |
R2356 |
T4055 |
T4054 |
aux |
has,described |
R2357 |
T4056 |
T4057 |
amod |
human,genes |
R2358 |
T4057 |
T4054 |
dobj |
genes,described |
R2359 |
T4058 |
T4057 |
compound |
ACDP,genes |
R236 |
T477 |
T478 |
amod |
diverse,species |
R2360 |
T4059 |
T4060 |
punct |
[,1 |
R2361 |
T4060 |
T4054 |
parataxis |
1,described |
R2362 |
T4061 |
T4060 |
punct |
],1 |
R2363 |
T4062 |
T4054 |
punct |
.,described |
R2364 |
T4064 |
T4065 |
det |
The,information |
R2365 |
T4065 |
T4067 |
nsubj |
information,includes |
R2366 |
T4066 |
T4065 |
amod |
new,information |
R2367 |
T4067 |
T4072 |
ccomp |
includes,is |
R2368 |
T4068 |
T4065 |
prep |
of,information |
R2369 |
T4069 |
T4070 |
det |
the,work |
R237 |
T478 |
T476 |
pobj |
species,in |
R2370 |
T4070 |
T4068 |
pobj |
work,of |
R2371 |
T4071 |
T4070 |
amod |
current,work |
R2372 |
T4073 |
T4067 |
punct |
: ,includes |
R2373 |
T4074 |
T4072 |
meta |
1,is |
R2374 |
T4075 |
T4074 |
punct |
),1 |
R2375 |
T4076 |
T4074 |
punct |
.,1 |
R2376 |
T4077 |
T4072 |
nsubj |
It,is |
R2377 |
T4078 |
T4079 |
det |
the,time |
R2378 |
T4079 |
T4072 |
attr |
time,is |
R2379 |
T4080 |
T4079 |
amod |
first,time |
R238 |
T479 |
T473 |
cc |
and,conserved |
R2380 |
T4081 |
T4082 |
aux |
to,report |
R2381 |
T4082 |
T4079 |
advcl |
report,time |
R2382 |
T4083 |
T4084 |
det |
the,existence |
R2383 |
T4084 |
T4082 |
dobj |
existence,report |
R2384 |
T4085 |
T4084 |
prep |
of,existence |
R2385 |
T4086 |
T4087 |
amod |
multiple,genes |
R2386 |
T4087 |
T4085 |
pobj |
genes,of |
R2387 |
T4088 |
T4087 |
compound |
Acdp,genes |
R2388 |
T4089 |
T4082 |
prep |
in,report |
R2389 |
T4090 |
T4091 |
amod |
other,mammals |
R239 |
T480 |
T481 |
advmod |
ubiquitously,expressed |
R2390 |
T4091 |
T4089 |
pobj |
mammals,in |
R2391 |
T4092 |
T4091 |
prep |
in,mammals |
R2392 |
T4093 |
T4092 |
pobj |
addition,in |
R2393 |
T4094 |
T4093 |
prep |
to,addition |
R2394 |
T4095 |
T4094 |
pobj |
human,to |
R2395 |
T4096 |
T4072 |
punct |
", ",is |
R2396 |
T4097 |
T4098 |
mark |
while,appears |
R2397 |
T4098 |
T4072 |
advcl |
appears,is |
R2398 |
T4099 |
T4098 |
nsubj |
Acdp,appears |
R2399 |
T4100 |
T4101 |
aux |
to,be |
R24 |
T245 |
T243 |
compound |
domain,protein |
R240 |
T481 |
T473 |
conj |
expressed,conserved |
R2400 |
T4101 |
T4098 |
xcomp |
be,appears |
R2401 |
T4102 |
T4103 |
det |
a,gene |
R2402 |
T4103 |
T4101 |
attr |
gene,be |
R2403 |
T4104 |
T4103 |
amod |
single,gene |
R2404 |
T4105 |
T4103 |
compound |
copy,gene |
R2405 |
T4106 |
T4103 |
prep |
in,gene |
R2406 |
T4107 |
T4108 |
amod |
lower,organisms |
R2407 |
T4108 |
T4106 |
pobj |
organisms,in |
R2408 |
T4109 |
T4110 |
amod |
such,as |
R2409 |
T4110 |
T4101 |
prep |
as,be |
R241 |
T482 |
T481 |
prep |
throughout,expressed |
R2410 |
T4111 |
T4110 |
prep |
in,as |
R2411 |
T4112 |
T4113 |
compound |
C.,elegans |
R2412 |
T4113 |
T4111 |
pobj |
elegans,in |
R2413 |
T4114 |
T4113 |
punct |
", ",elegans |
R2414 |
T4115 |
T4113 |
conj |
yeasts,elegans |
R2415 |
T4116 |
T4115 |
cc |
and,yeasts |
R2416 |
T4117 |
T4115 |
conj |
bacteria,yeasts |
R2417 |
T4118 |
T4072 |
punct |
.,is |
R2418 |
T4120 |
T4121 |
nsubj |
We,suggested |
R2419 |
T4121 |
T4124 |
ccomp |
suggested,generated |
R242 |
T483 |
T482 |
pobj |
development,throughout |
R2420 |
T4122 |
T4121 |
aux |
have,suggested |
R2421 |
T4123 |
T4121 |
advmod |
also,suggested |
R2422 |
T4125 |
T4126 |
det |
the,relationships |
R2423 |
T4126 |
T4121 |
dobj |
relationships,suggested |
R2424 |
T4127 |
T4126 |
amod |
evolutionary,relationships |
R2425 |
T4128 |
T4126 |
prep |
of,relationships |
R2426 |
T4129 |
T4130 |
compound |
Acdp,genes |
R2427 |
T4130 |
T4128 |
pobj |
genes,of |
R2428 |
T4131 |
T4130 |
prep |
in,genes |
R2429 |
T4132 |
T4133 |
amod |
different,species |
R243 |
T484 |
T483 |
cc |
and,development |
R2430 |
T4133 |
T4131 |
pobj |
species,in |
R2431 |
T4134 |
T4135 |
punct |
(,tree |
R2432 |
T4135 |
T4121 |
parataxis |
tree,suggested |
R2433 |
T4136 |
T4135 |
amod |
phylogenetic,tree |
R2434 |
T4137 |
T4135 |
punct |
),tree |
R2435 |
T4138 |
T4124 |
punct |
;,generated |
R2436 |
T4139 |
T4140 |
meta |
2,are |
R2437 |
T4140 |
T4124 |
ccomp |
are,generated |
R2438 |
T4141 |
T4139 |
punct |
),2 |
R2439 |
T4142 |
T4139 |
punct |
.,2 |
R244 |
T485 |
T486 |
amod |
adult,tissues |
R2440 |
T4143 |
T4144 |
amod |
Molecular,cloning |
R2441 |
T4144 |
T4140 |
nsubj |
cloning,are |
R2442 |
T4145 |
T4144 |
cc |
and,cloning |
R2443 |
T4146 |
T4144 |
conj |
characterization,cloning |
R2444 |
T4147 |
T4144 |
prep |
of,cloning |
R2445 |
T4148 |
T4149 |
amod |
murine,family |
R2446 |
T4149 |
T4147 |
pobj |
family,of |
R2447 |
T4150 |
T4149 |
compound |
Acdp,family |
R2448 |
T4151 |
T4149 |
compound |
gene,family |
R2449 |
T4152 |
T4140 |
acomp |
essential,are |
R245 |
T486 |
T483 |
conj |
tissues,development |
R2450 |
T4153 |
T4140 |
prep |
for,are |
R2451 |
T4154 |
T4153 |
pobj |
study,for |
R2452 |
T4155 |
T4154 |
prep |
of,study |
R2453 |
T4156 |
T4157 |
det |
this,family |
R2454 |
T4157 |
T4155 |
pobj |
family,of |
R2455 |
T4158 |
T4157 |
amod |
novel,family |
R2456 |
T4159 |
T4157 |
compound |
gene,family |
R2457 |
T4160 |
T4154 |
prep |
in,study |
R2458 |
T4161 |
T4162 |
compound |
animal,model |
R2459 |
T4162 |
T4160 |
pobj |
model,in |
R246 |
T487 |
T473 |
advcl |
suggesting,conserved |
R2460 |
T4163 |
T4153 |
punct |
", ",for |
R2461 |
T4164 |
T4165 |
advmod |
e.g.,for |
R2462 |
T4165 |
T4153 |
prep |
for,for |
R2463 |
T4166 |
T4165 |
pobj |
generation,for |
R2464 |
T4167 |
T4166 |
prep |
of,generation |
R2465 |
T4168 |
T4169 |
nmod |
knockout,models |
R2466 |
T4169 |
T4167 |
pobj |
models,of |
R2467 |
T4170 |
T4168 |
cc |
or,knockout |
R2468 |
T4171 |
T4168 |
conj |
transgenic,knockout |
R2469 |
T4172 |
T4124 |
punct |
;,generated |
R247 |
T488 |
T489 |
mark |
that,be |
R2470 |
T4173 |
T4174 |
meta |
3,demonstrated |
R2471 |
T4174 |
T4124 |
ccomp |
demonstrated,generated |
R2472 |
T4175 |
T4173 |
punct |
),3 |
R2473 |
T4176 |
T4173 |
punct |
.,3 |
R2474 |
T4177 |
T4174 |
nsubj |
We,demonstrated |
R2475 |
T4178 |
T4174 |
aux |
have,demonstrated |
R2476 |
T4179 |
T4180 |
preconj |
both,DNA |
R2477 |
T4180 |
T4181 |
nmod |
DNA,conservations |
R2478 |
T4181 |
T4174 |
dobj |
conservations,demonstrated |
R2479 |
T4182 |
T4180 |
cc |
and,DNA |
R248 |
T489 |
T487 |
ccomp |
be,suggesting |
R2480 |
T4183 |
T4184 |
compound |
amino,acid |
R2481 |
T4184 |
T4180 |
conj |
acid,DNA |
R2482 |
T4185 |
T4181 |
prep |
between,conservations |
R2483 |
T4186 |
T4185 |
pobj |
mouse,between |
R2484 |
T4187 |
T4186 |
cc |
and,mouse |
R2485 |
T4188 |
T4186 |
conj |
human,mouse |
R2486 |
T4189 |
T4174 |
prep |
for,demonstrated |
R2487 |
T4190 |
T4191 |
det |
each,gene |
R2488 |
T4191 |
T4189 |
pobj |
gene,for |
R2489 |
T4192 |
T4191 |
compound |
Acdp,gene |
R249 |
T490 |
T489 |
nsubj |
Acdp,be |
R2490 |
T4193 |
T4191 |
cc |
and,gene |
R2491 |
T4194 |
T4195 |
det |
the,family |
R2492 |
T4195 |
T4191 |
conj |
family,gene |
R2493 |
T4196 |
T4195 |
amod |
whole,family |
R2494 |
T4197 |
T4195 |
compound |
Acdp,family |
R2495 |
T4198 |
T4195 |
compound |
gene,family |
R2496 |
T4199 |
T4191 |
punct |
", ",gene |
R2497 |
T4200 |
T4201 |
dep |
which,provide |
R2498 |
T4201 |
T4191 |
relcl |
provide,gene |
R2499 |
T4202 |
T4203 |
amod |
important,information |
R25 |
T246 |
T243 |
punct |
(,protein |
R250 |
T491 |
T489 |
aux |
may,be |
R2500 |
T4203 |
T4201 |
dobj |
information,provide |
R2501 |
T4204 |
T4203 |
prep |
for,information |
R2502 |
T4205 |
T4206 |
det |
the,possibility |
R2503 |
T4206 |
T4204 |
pobj |
possibility,for |
R2504 |
T4207 |
T4206 |
prep |
of,possibility |
R2505 |
T4208 |
T4209 |
amod |
functional,redundancy |
R2506 |
T4209 |
T4207 |
pobj |
redundancy,of |
R2507 |
T4210 |
T4209 |
cc |
or,redundancy |
R2508 |
T4211 |
T4209 |
conj |
overlap,redundancy |
R2509 |
T4212 |
T4209 |
prep |
between,redundancy |
R251 |
T492 |
T493 |
det |
an,gene |
R2510 |
T4213 |
T4214 |
compound |
Acdp,members |
R2511 |
T4214 |
T4212 |
pobj |
members,between |
R2512 |
T4215 |
T4124 |
punct |
;,generated |
R2513 |
T4216 |
T4124 |
meta |
4,generated |
R2514 |
T4217 |
T4216 |
punct |
),4 |
R2515 |
T4218 |
T4216 |
punct |
.,4 |
R2516 |
T4219 |
T4124 |
nsubj |
We,generated |
R2517 |
T4220 |
T4124 |
aux |
have,generated |
R2518 |
T4221 |
T4124 |
dobj |
antibodies,generated |
R2519 |
T4222 |
T4221 |
amod |
specific,antibodies |
R252 |
T493 |
T489 |
attr |
gene,be |
R2520 |
T4223 |
T4222 |
prep |
for,specific |
R2521 |
T4224 |
T4223 |
pobj |
Acdp1,for |
R2522 |
T4225 |
T4224 |
cc |
and,Acdp1 |
R2523 |
T4226 |
T4227 |
det |
all,proteins |
R2524 |
T4227 |
T4224 |
conj |
proteins,Acdp1 |
R2525 |
T4228 |
T4227 |
compound |
Acdp,proteins |
R2526 |
T4229 |
T4124 |
punct |
.,generated |
R2527 |
T4231 |
T4232 |
det |
The,antibody |
R2528 |
T4232 |
T4237 |
nsubj |
antibody,appears |
R2529 |
T4233 |
T4232 |
compound |
Acdp1,antibody |
R253 |
T494 |
T493 |
amod |
essential,gene |
R2530 |
T4234 |
T4235 |
compound |
C,terminus |
R2531 |
T4235 |
T4232 |
compound |
terminus,antibody |
R2532 |
T4236 |
T4235 |
punct |
-,terminus |
R2533 |
T4238 |
T4239 |
aux |
to,recognize |
R2534 |
T4239 |
T4237 |
xcomp |
recognize,appears |
R2535 |
T4240 |
T4239 |
advmod |
specifically,recognize |
R2536 |
T4241 |
T4239 |
dobj |
Acdp1,recognize |
R2537 |
T4242 |
T4237 |
punct |
.,appears |
R2538 |
T4244 |
T4245 |
advcl |
Using,demonstrated |
R2539 |
T4246 |
T4247 |
det |
this,antibody |
R254 |
T495 |
T473 |
punct |
.,conserved |
R2540 |
T4247 |
T4244 |
dobj |
antibody,Using |
R2541 |
T4248 |
T4245 |
punct |
", ",demonstrated |
R2542 |
T4249 |
T4245 |
nsubj |
we,demonstrated |
R2543 |
T4250 |
T4245 |
aux |
have,demonstrated |
R2544 |
T4251 |
T4252 |
mark |
that,localized |
R2545 |
T4252 |
T4245 |
ccomp |
localized,demonstrated |
R2546 |
T4253 |
T4252 |
nsubjpass |
Acdp1,localized |
R2547 |
T4254 |
T4252 |
auxpass |
is,localized |
R2548 |
T4255 |
T4252 |
advmod |
predominantly,localized |
R2549 |
T4256 |
T4252 |
prep |
on,localized |
R255 |
T497 |
T498 |
nsubj |
Acdp,showed |
R2550 |
T4257 |
T4258 |
det |
the,membrane |
R2551 |
T4258 |
T4256 |
pobj |
membrane,on |
R2552 |
T4259 |
T4258 |
compound |
plasma,membrane |
R2553 |
T4260 |
T4252 |
prep |
in,localized |
R2554 |
T4261 |
T4262 |
compound |
hippocampus,neurons |
R2555 |
T4262 |
T4260 |
pobj |
neurons,in |
R2556 |
T4263 |
T4245 |
punct |
.,demonstrated |
R2557 |
T4265 |
T4266 |
det |
These,results |
R2558 |
T4266 |
T4267 |
nsubj |
results,represent |
R2559 |
T4268 |
T4269 |
det |
an,step |
R256 |
T499 |
T500 |
amod |
strong,homology |
R2560 |
T4269 |
T4267 |
dobj |
step,represent |
R2561 |
T4270 |
T4269 |
amod |
important,step |
R2562 |
T4271 |
T4269 |
prep |
towards,step |
R2563 |
T4272 |
T4273 |
det |
the,characterization |
R2564 |
T4273 |
T4271 |
pobj |
characterization,towards |
R2565 |
T4274 |
T4273 |
prep |
of,characterization |
R2566 |
T4275 |
T4274 |
pobj |
functions,of |
R2567 |
T4276 |
T4273 |
prep |
for,characterization |
R2568 |
T4277 |
T4278 |
det |
the,family |
R2569 |
T4278 |
T4276 |
pobj |
family,for |
R257 |
T500 |
T498 |
dobj |
homology,showed |
R2570 |
T4279 |
T4278 |
compound |
Acdp,family |
R2571 |
T4280 |
T4278 |
compound |
gene,family |
R2572 |
T4281 |
T4267 |
punct |
.,represent |
R2573 |
T4392 |
T4393 |
compound |
cDNA,cloning |
R2574 |
T4395 |
T4396 |
compound |
cDNA,cloning |
R2575 |
T4396 |
T4397 |
nsubjpass |
cloning,performed |
R2576 |
T4398 |
T4396 |
prep |
of,cloning |
R2577 |
T4399 |
T4400 |
det |
the,family |
R2578 |
T4400 |
T4398 |
pobj |
family,of |
R2579 |
T4401 |
T4400 |
compound |
Acdp,family |
R258 |
T501 |
T498 |
prep |
to,showed |
R2580 |
T4402 |
T4400 |
compound |
gene,family |
R2581 |
T4403 |
T4397 |
auxpass |
was,performed |
R2582 |
T4404 |
T4397 |
prep |
based,performed |
R2583 |
T4405 |
T4404 |
prep |
on,based |
R2584 |
T4406 |
T4407 |
amod |
human,sequences |
R2585 |
T4407 |
T4405 |
pobj |
sequences,on |
R2586 |
T4408 |
T4407 |
compound |
homologue,sequences |
R2587 |
T4409 |
T4410 |
mark |
as,reported |
R2588 |
T4410 |
T4397 |
advcl |
reported,performed |
R2589 |
T4411 |
T4410 |
advmod |
previously,reported |
R259 |
T502 |
T503 |
compound |
bacteria,protein |
R2590 |
T4412 |
T4413 |
punct |
[,2 |
R2591 |
T4413 |
T4397 |
parataxis |
2,performed |
R2592 |
T4414 |
T4413 |
punct |
],2 |
R2593 |
T4415 |
T4397 |
punct |
.,performed |
R2594 |
T4417 |
T4418 |
advmod |
Briefly,used |
R2595 |
T4419 |
T4418 |
punct |
", ",used |
R2596 |
T4420 |
T4421 |
det |
the,cDNAs |
R2597 |
T4421 |
T4418 |
nsubjpass |
cDNAs,used |
R2598 |
T4422 |
T4421 |
amod |
human,cDNAs |
R2599 |
T4423 |
T4421 |
compound |
ACDP,cDNAs |
R26 |
T247 |
T243 |
appos |
ACDP,protein |
R260 |
T503 |
T501 |
pobj |
protein,to |
R2600 |
T4424 |
T4421 |
cc |
and,cDNAs |
R2601 |
T4425 |
T4426 |
amod |
predicted,sequences |
R2602 |
T4426 |
T4421 |
conj |
sequences,cDNAs |
R2603 |
T4427 |
T4426 |
compound |
AA,sequences |
R2604 |
T4428 |
T4418 |
auxpass |
were,used |
R2605 |
T4429 |
T4430 |
aux |
to,search |
R2606 |
T4430 |
T4418 |
advcl |
search,used |
R2607 |
T4431 |
T4432 |
det |
the,database |
R2608 |
T4432 |
T4430 |
dobj |
database,search |
R2609 |
T4433 |
T4432 |
compound |
mouse,database |
R261 |
T504 |
T503 |
compound |
CorC,protein |
R2610 |
T4434 |
T4432 |
compound |
EST,database |
R2611 |
T4435 |
T4430 |
prep |
for,search |
R2612 |
T4436 |
T4437 |
compound |
EST,markers |
R2613 |
T4437 |
T4435 |
pobj |
markers,for |
R2614 |
T4438 |
T4437 |
acl |
corresponding,markers |
R2615 |
T4439 |
T4438 |
prep |
to,corresponding |
R2616 |
T4440 |
T4441 |
det |
each,member |
R2617 |
T4441 |
T4439 |
pobj |
member,to |
R2618 |
T4442 |
T4441 |
compound |
Acdp,member |
R2619 |
T4443 |
T4418 |
punct |
.,used |
R262 |
T505 |
T498 |
cc |
and,showed |
R2620 |
T4445 |
T4446 |
det |
A,primer |
R2621 |
T4446 |
T4448 |
nsubjpass |
primer,used |
R2622 |
T4447 |
T4446 |
amod |
forward,primer |
R2623 |
T4449 |
T4446 |
prep |
within,primer |
R2624 |
T4450 |
T4451 |
det |
the,region |
R2625 |
T4451 |
T4449 |
pobj |
region,within |
R2626 |
T4452 |
T4451 |
amod |
human,region |
R2627 |
T4453 |
T4451 |
nmod |
ACDP,region |
R2628 |
T4454 |
T4451 |
nummod |
5,region |
R2629 |
T4455 |
T4454 |
punct |
',5 |
R263 |
T506 |
T507 |
advmod |
predominantly,localized |
R2630 |
T4456 |
T4451 |
compound |
cDNA,region |
R2631 |
T4457 |
T4451 |
compound |
coding,region |
R2632 |
T4458 |
T4446 |
punct |
(,primer |
R2633 |
T4459 |
T4446 |
prep |
after,primer |
R2634 |
T4460 |
T4461 |
compound |
start,codon |
R2635 |
T4461 |
T4459 |
pobj |
codon,after |
R2636 |
T4462 |
T4446 |
punct |
),primer |
R2637 |
T4463 |
T4446 |
cc |
and,primer |
R2638 |
T4464 |
T4465 |
det |
a,primer |
R2639 |
T4465 |
T4446 |
conj |
primer,primer |
R264 |
T507 |
T498 |
conj |
localized,showed |
R2640 |
T4466 |
T4465 |
nmod |
mouse,primer |
R2641 |
T4467 |
T4465 |
amod |
reverse,primer |
R2642 |
T4468 |
T4465 |
prep |
from,primer |
R2643 |
T4469 |
T4470 |
det |
the,marker |
R2644 |
T4470 |
T4468 |
pobj |
marker,from |
R2645 |
T4471 |
T4470 |
compound |
mouse,marker |
R2646 |
T4472 |
T4470 |
compound |
EST,marker |
R2647 |
T4473 |
T4448 |
auxpass |
were,used |
R2648 |
T4474 |
T4475 |
aux |
to,amplify |
R2649 |
T4475 |
T4448 |
advcl |
amplify,used |
R265 |
T508 |
T507 |
prep |
on,localized |
R2650 |
T4476 |
T4477 |
det |
the,sequence |
R2651 |
T4477 |
T4475 |
dobj |
sequence,amplify |
R2652 |
T4478 |
T4477 |
compound |
homologue,sequence |
R2653 |
T4479 |
T4475 |
prep |
from,amplify |
R2654 |
T4480 |
T4481 |
compound |
mouse,cDNA |
R2655 |
T4481 |
T4479 |
pobj |
cDNA,from |
R2656 |
T4482 |
T4475 |
prep |
at,amplify |
R2657 |
T4483 |
T4484 |
advmod |
very,low |
R2658 |
T4484 |
T4485 |
amod |
low,temperature |
R2659 |
T4485 |
T4482 |
pobj |
temperature,at |
R266 |
T509 |
T510 |
det |
the,membrane |
R2660 |
T4486 |
T4485 |
amod |
annealing,temperature |
R2661 |
T4487 |
T4485 |
punct |
(,temperature |
R2662 |
T4488 |
T4489 |
quantmod |
45,50 |
R2663 |
T4489 |
T4491 |
nummod |
50,°C |
R2664 |
T4490 |
T4489 |
punct |
–,50 |
R2665 |
T4491 |
T4485 |
appos |
°C,temperature |
R2666 |
T4492 |
T4448 |
punct |
),used |
R2667 |
T4493 |
T4448 |
punct |
.,used |
R2668 |
T4495 |
T4496 |
det |
A,PCR |
R2669 |
T4496 |
T4498 |
nsubjpass |
PCR,carried |
R267 |
T510 |
T508 |
pobj |
membrane,on |
R2670 |
T4497 |
T4496 |
amod |
nested,PCR |
R2671 |
T4499 |
T4496 |
acl |
using,PCR |
R2672 |
T4500 |
T4501 |
det |
an,primer |
R2673 |
T4501 |
T4499 |
dobj |
primer,using |
R2674 |
T4502 |
T4501 |
amod |
inside,primer |
R2675 |
T4503 |
T4501 |
amod |
reverse,primer |
R2676 |
T4504 |
T4501 |
prep |
from,primer |
R2677 |
T4505 |
T4506 |
det |
the,sequence |
R2678 |
T4506 |
T4504 |
pobj |
sequence,from |
R2679 |
T4507 |
T4506 |
compound |
mouse,sequence |
R268 |
T511 |
T510 |
compound |
plasma,membrane |
R2680 |
T4508 |
T4506 |
compound |
EST,sequence |
R2681 |
T4509 |
T4501 |
cc |
and,primer |
R2682 |
T4510 |
T4511 |
det |
the,primer |
R2683 |
T4511 |
T4501 |
conj |
primer,primer |
R2684 |
T4512 |
T4511 |
amod |
same,primer |
R2685 |
T4513 |
T4511 |
amod |
human,primer |
R2686 |
T4514 |
T4511 |
amod |
forward,primer |
R2687 |
T4515 |
T4498 |
auxpass |
was,carried |
R2688 |
T4516 |
T4498 |
advmod |
then,carried |
R2689 |
T4517 |
T4498 |
prt |
out,carried |
R269 |
T512 |
T498 |
punct |
.,showed |
R2690 |
T4518 |
T4519 |
aux |
to,amplify |
R2691 |
T4519 |
T4498 |
advcl |
amplify,carried |
R2692 |
T4520 |
T4521 |
det |
the,gene |
R2693 |
T4521 |
T4519 |
dobj |
gene,amplify |
R2694 |
T4522 |
T4521 |
amod |
specific,gene |
R2695 |
T4523 |
T4521 |
compound |
mouse,gene |
R2696 |
T4524 |
T4521 |
prep |
from,gene |
R2697 |
T4525 |
T4526 |
det |
the,products |
R2698 |
T4526 |
T4524 |
pobj |
products,from |
R2699 |
T4527 |
T4528 |
amod |
first,round |
R27 |
T248 |
T241 |
punct |
),named |
R270 |
T514 |
T515 |
det |
These,results |
R2700 |
T4528 |
T4526 |
compound |
round,products |
R2701 |
T4529 |
T4526 |
compound |
PCR,products |
R2702 |
T4530 |
T4519 |
prep |
at,amplify |
R2703 |
T4531 |
T4532 |
amod |
high,temperature |
R2704 |
T4532 |
T4530 |
pobj |
temperature,at |
R2705 |
T4533 |
T4532 |
amod |
annealing,temperature |
R2706 |
T4534 |
T4532 |
punct |
(,temperature |
R2707 |
T4535 |
T4536 |
nummod |
62,°C |
R2708 |
T4536 |
T4532 |
appos |
°C,temperature |
R2709 |
T4537 |
T4498 |
punct |
),carried |
R271 |
T515 |
T516 |
nsubj |
results,suggest |
R2710 |
T4538 |
T4498 |
punct |
.,carried |
R2711 |
T4540 |
T4541 |
det |
The,products |
R2712 |
T4541 |
T4544 |
nsubjpass |
products,excised |
R2713 |
T4542 |
T4541 |
amod |
expected,products |
R2714 |
T4543 |
T4541 |
compound |
PCR,products |
R2715 |
T4545 |
T4544 |
auxpass |
were,excised |
R2716 |
T4546 |
T4544 |
advmod |
directly,excised |
R2717 |
T4547 |
T4544 |
prep |
from,excised |
R2718 |
T4548 |
T4549 |
compound |
agarose,gel |
R2719 |
T4549 |
T4547 |
pobj |
gel,from |
R272 |
T517 |
T518 |
mark |
that,is |
R2720 |
T4550 |
T4544 |
cc |
and,excised |
R2721 |
T4551 |
T4544 |
conj |
sequenced,excised |
R2722 |
T4552 |
T4551 |
prep |
by,sequenced |
R2723 |
T4553 |
T4554 |
det |
an,sequencer |
R2724 |
T4554 |
T4552 |
pobj |
sequencer,by |
R2725 |
T4555 |
T4554 |
nmod |
ABI377,sequencer |
R2726 |
T4556 |
T4554 |
amod |
automatic,sequencer |
R2727 |
T4557 |
T4544 |
punct |
.,excised |
R2728 |
T4559 |
T4560 |
det |
The,sequence |
R2729 |
T4560 |
T4561 |
nsubjpass |
sequence,confirmed |
R273 |
T518 |
T516 |
ccomp |
is,suggest |
R2730 |
T4562 |
T4561 |
auxpass |
was,confirmed |
R2731 |
T4563 |
T4561 |
advmod |
further,confirmed |
R2732 |
T4564 |
T4561 |
advcl |
using,confirmed |
R2733 |
T4565 |
T4566 |
det |
a,primer |
R2734 |
T4566 |
T4564 |
dobj |
primer,using |
R2735 |
T4567 |
T4566 |
amod |
forward,primer |
R2736 |
T4568 |
T4566 |
prep |
from,primer |
R2737 |
T4569 |
T4570 |
advmod |
newly,identified |
R2738 |
T4570 |
T4571 |
amod |
identified,sequence |
R2739 |
T4571 |
T4568 |
pobj |
sequence,from |
R274 |
T519 |
T518 |
nsubj |
Acdp,is |
R2740 |
T4572 |
T4566 |
cc |
and,primer |
R2741 |
T4573 |
T4574 |
det |
a,primer |
R2742 |
T4574 |
T4566 |
conj |
primer,primer |
R2743 |
T4575 |
T4574 |
amod |
reverse,primer |
R2744 |
T4576 |
T4574 |
prep |
from,primer |
R2745 |
T4577 |
T4578 |
amod |
known,sequence |
R2746 |
T4578 |
T4576 |
pobj |
sequence,from |
R2747 |
T4579 |
T4561 |
punct |
.,confirmed |
R2748 |
T4581 |
T4582 |
mark |
Once,identified |
R2749 |
T4582 |
T4589 |
advcl |
identified,obtained |
R275 |
T520 |
T518 |
advmod |
probably,is |
R2750 |
T4583 |
T4582 |
nsubjpass |
most,identified |
R2751 |
T4584 |
T4583 |
prep |
of,most |
R2752 |
T4585 |
T4586 |
det |
the,sequences |
R2753 |
T4586 |
T4584 |
pobj |
sequences,of |
R2754 |
T4587 |
T4586 |
amod |
coding,sequences |
R2755 |
T4588 |
T4582 |
auxpass |
were,identified |
R2756 |
T4590 |
T4589 |
punct |
", ",obtained |
R2757 |
T4591 |
T4592 |
amod |
partial,sequence |
R2758 |
T4592 |
T4589 |
nsubjpass |
sequence,obtained |
R2759 |
T4593 |
T4592 |
prep |
of,sequence |
R276 |
T521 |
T522 |
det |
a,family |
R2760 |
T4594 |
T4595 |
nmod |
exon,sequences |
R2761 |
T4595 |
T4593 |
pobj |
sequences,of |
R2762 |
T4596 |
T4594 |
nummod |
1,exon |
R2763 |
T4597 |
T4594 |
cc |
and,exon |
R2764 |
T4598 |
T4599 |
det |
the,UTR |
R2765 |
T4599 |
T4594 |
conj |
UTR,exon |
R2766 |
T4600 |
T4599 |
nummod |
5,UTR |
R2767 |
T4601 |
T4600 |
punct |
',5 |
R2768 |
T4602 |
T4589 |
auxpass |
were,obtained |
R2769 |
T4603 |
T4589 |
prep |
by,obtained |
R277 |
T522 |
T518 |
attr |
family,is |
R2770 |
T4604 |
T4605 |
compound |
BAC,sequencing |
R2771 |
T4605 |
T4603 |
pobj |
sequencing,by |
R2772 |
T4606 |
T4605 |
compound |
DNA,sequencing |
R2773 |
T4607 |
T4589 |
punct |
.,obtained |
R2774 |
T4647 |
T4648 |
compound |
Northern,blot |
R2775 |
T4648 |
T4649 |
compound |
blot,analyses |
R2776 |
T4651 |
T4652 |
amod |
Multiple,filters |
R2777 |
T4652 |
T4656 |
nsubjpass |
filters,purchased |
R2778 |
T4653 |
T4652 |
compound |
Choice,filters |
R2779 |
T4654 |
T4655 |
compound |
Northern,Blot |
R278 |
T523 |
T522 |
prep |
of,family |
R2780 |
T4655 |
T4652 |
compound |
Blot,filters |
R2781 |
T4657 |
T4652 |
acl |
containing,filters |
R2782 |
T4658 |
T4659 |
nummod |
12,tissues |
R2783 |
T4659 |
T4657 |
dobj |
tissues,containing |
R2784 |
T4660 |
T4659 |
amod |
different,tissues |
R2785 |
T4661 |
T4659 |
compound |
mouse,tissues |
R2786 |
T4662 |
T4656 |
auxpass |
were,purchased |
R2787 |
T4663 |
T4656 |
prep |
from,purchased |
R2788 |
T4664 |
T4663 |
pobj |
Origene,from |
R2789 |
T4665 |
T4656 |
punct |
.,purchased |
R279 |
T524 |
T523 |
pobj |
proteins,of |
R2790 |
T4667 |
T4668 |
det |
The,filters |
R2791 |
T4668 |
T4669 |
nsubjpass |
filters,probed |
R2792 |
T4670 |
T4669 |
auxpass |
were,probed |
R2793 |
T4671 |
T4669 |
prep |
for,probed |
R2794 |
T4672 |
T4673 |
det |
each,gene |
R2795 |
T4673 |
T4671 |
pobj |
gene,for |
R2796 |
T4674 |
T4673 |
compound |
Acdp,gene |
R2797 |
T4675 |
T4669 |
prep |
with,probed |
R2798 |
T4676 |
T4677 |
det |
a,fragment |
R2799 |
T4677 |
T4675 |
pobj |
fragment,with |
R28 |
T249 |
T236 |
prep |
in,characterized |
R280 |
T525 |
T524 |
acl |
involved,proteins |
R2800 |
T4678 |
T4677 |
compound |
PCR,fragment |
R2801 |
T4679 |
T4680 |
punct |
(,bp |
R2802 |
T4680 |
T4677 |
parataxis |
bp,fragment |
R2803 |
T4681 |
T4682 |
quantmod |
around,350 |
R2804 |
T4682 |
T4680 |
nummod |
350,bp |
R2805 |
T4683 |
T4680 |
punct |
),bp |
R2806 |
T4684 |
T4677 |
prep |
from,fragment |
R2807 |
T4685 |
T4686 |
amod |
last,exon |
R2808 |
T4686 |
T4684 |
pobj |
exon,from |
R2809 |
T4687 |
T4669 |
cc |
and,probed |
R281 |
T526 |
T525 |
prep |
in,involved |
R2810 |
T4688 |
T4689 |
det |
the,3 |
R2811 |
T4689 |
T4690 |
nummod |
3,region |
R2812 |
T4690 |
T4693 |
nsubj |
region,labeled |
R2813 |
T4691 |
T4689 |
punct |
',3 |
R2814 |
T4692 |
T4689 |
amod |
untranslated,3 |
R2815 |
T4693 |
T4669 |
conj |
labeled,probed |
R2816 |
T4694 |
T4693 |
prep |
with,labeled |
R2817 |
T4695 |
T4696 |
compound |
α,32P |
R2818 |
T4696 |
T4698 |
compound |
32P,dCTP |
R2819 |
T4697 |
T4696 |
punct |
-,32P |
R282 |
T527 |
T528 |
compound |
ion,transport |
R2820 |
T4698 |
T4694 |
pobj |
dCTP,with |
R2821 |
T4699 |
T4693 |
advcl |
using,labeled |
R2822 |
T4700 |
T4701 |
det |
the,system |
R2823 |
T4701 |
T4699 |
dobj |
system,using |
R2824 |
T4702 |
T4701 |
amod |
random,system |
R2825 |
T4703 |
T4701 |
compound |
primer,system |
R2826 |
T4704 |
T4701 |
compound |
extension,system |
R2827 |
T4705 |
T4706 |
punct |
(,Technologies |
R2828 |
T4706 |
T4701 |
parataxis |
Technologies,system |
R2829 |
T4707 |
T4706 |
compound |
Life,Technologies |
R283 |
T528 |
T526 |
pobj |
transport,in |
R2830 |
T4708 |
T4706 |
punct |
),Technologies |
R2831 |
T4709 |
T4693 |
punct |
.,labeled |
R2832 |
T4711 |
T4712 |
nsubjpass |
Hybridizations,carried |
R2833 |
T4713 |
T4712 |
auxpass |
were,carried |
R2834 |
T4714 |
T4712 |
prt |
out,carried |
R2835 |
T4715 |
T4712 |
advmod |
overnight,carried |
R2836 |
T4716 |
T4712 |
punct |
.,carried |
R2837 |
T4718 |
T4719 |
det |
The,filters |
R2838 |
T4719 |
T4720 |
nsubjpass |
filters,washed |
R2839 |
T4721 |
T4720 |
auxpass |
were,washed |
R284 |
T529 |
T525 |
prep |
in,involved |
R2840 |
T4722 |
T4720 |
advmod |
twice,washed |
R2841 |
T4723 |
T4720 |
prep |
with,washed |
R2842 |
T4724 |
T4725 |
amod |
washing,buffer |
R2843 |
T4725 |
T4723 |
pobj |
buffer,with |
R2844 |
T4726 |
T4725 |
nummod |
I,buffer |
R2845 |
T4727 |
T4728 |
punct |
(,SDS |
R2846 |
T4728 |
T4725 |
parataxis |
SDS,buffer |
R2847 |
T4729 |
T4730 |
nummod |
2,SSC |
R2848 |
T4730 |
T4728 |
dep |
SSC,SDS |
R2849 |
T4731 |
T4730 |
punct |
×,SSC |
R285 |
T530 |
T531 |
amod |
mammalian,cells |
R2850 |
T4732 |
T4728 |
punct |
", ",SDS |
R2851 |
T4733 |
T4734 |
nummod |
0.1,% |
R2852 |
T4734 |
T4728 |
compound |
%,SDS |
R2853 |
T4735 |
T4728 |
punct |
),SDS |
R2854 |
T4736 |
T4720 |
prep |
at,washed |
R2855 |
T4737 |
T4738 |
nummod |
42,°C |
R2856 |
T4738 |
T4736 |
pobj |
°C,at |
R2857 |
T4739 |
T4720 |
prep |
for,washed |
R2858 |
T4740 |
T4741 |
nummod |
15,min |
R2859 |
T4741 |
T4739 |
pobj |
min,for |
R286 |
T531 |
T529 |
pobj |
cells,in |
R2860 |
T4742 |
T4741 |
punct |
-,min |
R2861 |
T4743 |
T4720 |
punct |
", ",washed |
R2862 |
T4744 |
T4720 |
cc |
and,washed |
R2863 |
T4745 |
T4746 |
advmod |
then,washed |
R2864 |
T4746 |
T4720 |
conj |
washed,washed |
R2865 |
T4747 |
T4746 |
advmod |
twice,washed |
R2866 |
T4748 |
T4746 |
prep |
with,washed |
R2867 |
T4749 |
T4750 |
compound |
washing,buffer |
R2868 |
T4750 |
T4748 |
pobj |
buffer,with |
R2869 |
T4751 |
T4750 |
nummod |
II,buffer |
R287 |
T216 |
T217 |
amod |
Molecular,cloning |
R2870 |
T4752 |
T4753 |
punct |
(,SDS |
R2871 |
T4753 |
T4750 |
parataxis |
SDS,buffer |
R2872 |
T4754 |
T4755 |
nummod |
0.25,SSC |
R2873 |
T4755 |
T4753 |
dep |
SSC,SDS |
R2874 |
T4756 |
T4755 |
punct |
×,SSC |
R2875 |
T4757 |
T4753 |
punct |
", ",SDS |
R2876 |
T4758 |
T4759 |
nummod |
0.1,% |
R2877 |
T4759 |
T4753 |
compound |
%,SDS |
R2878 |
T4760 |
T4753 |
punct |
),SDS |
R2879 |
T4761 |
T4746 |
prep |
at,washed |
R288 |
T593 |
T594 |
nsubj |
We,cloned |
R2880 |
T4762 |
T4763 |
nummod |
65,°C |
R2881 |
T4763 |
T4761 |
pobj |
°C,at |
R2882 |
T4764 |
T4746 |
prep |
for,washed |
R2883 |
T4765 |
T4766 |
nummod |
15,min |
R2884 |
T4766 |
T4764 |
pobj |
min,for |
R2885 |
T4767 |
T4766 |
punct |
-,min |
R2886 |
T4768 |
T4720 |
punct |
.,washed |
R2887 |
T4770 |
T4771 |
amod |
Washed,filters |
R2888 |
T4771 |
T4772 |
nsubjpass |
filters,exposed |
R2889 |
T4773 |
T4772 |
auxpass |
were,exposed |
R289 |
T595 |
T594 |
aux |
have,cloned |
R2890 |
T4774 |
T4772 |
prep |
to,exposed |
R2891 |
T4775 |
T4776 |
compound |
X-ray,films |
R2892 |
T4776 |
T4774 |
pobj |
films,to |
R2893 |
T4777 |
T4772 |
prep |
for,exposed |
R2894 |
T4778 |
T4777 |
pcomp |
overnight,for |
R2895 |
T4779 |
T4778 |
cc |
or,overnight |
R2896 |
T4780 |
T4778 |
conj |
longer,overnight |
R2897 |
T4781 |
T4782 |
punct |
[,4 |
R2898 |
T4782 |
T4772 |
parataxis |
4,exposed |
R2899 |
T4783 |
T4782 |
nummod |
3,4 |
R29 |
T250 |
T249 |
pobj |
humans,in |
R290 |
T596 |
T594 |
advmod |
recently,cloned |
R2900 |
T4784 |
T4782 |
punct |
",",4 |
R2901 |
T4785 |
T4782 |
punct |
],4 |
R2902 |
T4786 |
T4772 |
punct |
.,exposed |
R2904 |
T4823 |
T4824 |
compound |
Antibody,production |
R2905 |
T4825 |
T4824 |
cc |
and,production |
R2906 |
T4826 |
T4827 |
compound |
Western,blot |
R2907 |
T4827 |
T4828 |
compound |
blot,analyses |
R2908 |
T4828 |
T4824 |
conj |
analyses,production |
R2909 |
T4830 |
T4831 |
nsubjpass |
Peptides,used |
R291 |
T597 |
T594 |
cc |
and,cloned |
R2910 |
T4832 |
T4830 |
acl |
linked,Peptides |
R2911 |
T4833 |
T4832 |
prep |
to,linked |
R2912 |
T4834 |
T4833 |
pobj |
KLH,to |
R2913 |
T4835 |
T4834 |
punct |
(,KLH |
R2914 |
T4836 |
T4837 |
compound |
keyhole,hemacyanin |
R2915 |
T4837 |
T4834 |
appos |
hemacyanin,KLH |
R2916 |
T4838 |
T4837 |
compound |
limpet,hemacyanin |
R2917 |
T4839 |
T4833 |
punct |
),to |
R2918 |
T4840 |
T4833 |
prep |
from,to |
R2919 |
T4841 |
T4842 |
nmod |
Acdp1,terminals |
R292 |
T598 |
T594 |
conj |
characterized,cloned |
R2920 |
T4842 |
T4840 |
pobj |
terminals,from |
R2921 |
T4843 |
T4842 |
nmod |
N,terminals |
R2922 |
T4844 |
T4843 |
punct |
-,N |
R2923 |
T4845 |
T4843 |
cc |
and,N |
R2924 |
T4846 |
T4843 |
conj |
C,N |
R2925 |
T4847 |
T4842 |
punct |
-,terminals |
R2926 |
T4848 |
T4842 |
cc |
and,terminals |
R2927 |
T4849 |
T4850 |
det |
the,domain |
R2928 |
T4850 |
T4842 |
conj |
domain,terminals |
R2929 |
T4851 |
T4850 |
amod |
conserved,domain |
R293 |
T599 |
T600 |
det |
a,family |
R2930 |
T4852 |
T4850 |
punct |
(,domain |
R2931 |
T4853 |
T4850 |
appos |
ACD,domain |
R2932 |
T4854 |
T4831 |
punct |
),used |
R2933 |
T4855 |
T4831 |
auxpass |
were,used |
R2934 |
T4856 |
T4831 |
prep |
for,used |
R2935 |
T4857 |
T4856 |
pobj |
generation,for |
R2936 |
T4858 |
T4857 |
prep |
of,generation |
R2937 |
T4859 |
T4858 |
pobj |
antibodies,of |
R2938 |
T4860 |
T4861 |
advmod |
specifically,for |
R2939 |
T4861 |
T4856 |
prep |
for,for |
R294 |
T600 |
T598 |
dobj |
family,characterized |
R2940 |
T4862 |
T4861 |
pobj |
Acdp1,for |
R2941 |
T4863 |
T4862 |
cc |
and,Acdp1 |
R2942 |
T4864 |
T4865 |
det |
all,members |
R2943 |
T4865 |
T4862 |
conj |
members,Acdp1 |
R2944 |
T4866 |
T4865 |
compound |
Acdp,members |
R2945 |
T4867 |
T4868 |
mark |
as,reported |
R2946 |
T4868 |
T4831 |
advcl |
reported,used |
R2947 |
T4869 |
T4831 |
punct |
", ",used |
R2948 |
T4870 |
T4831 |
advmod |
respectively,used |
R2949 |
T4871 |
T4872 |
punct |
[,5 |
R295 |
T601 |
T600 |
amod |
novel,family |
R2950 |
T4872 |
T4831 |
parataxis |
5,used |
R2951 |
T4873 |
T4872 |
punct |
],5 |
R2952 |
T4874 |
T4831 |
punct |
.,used |
R2953 |
T4876 |
T4877 |
compound |
Western,blots |
R2954 |
T4877 |
T4878 |
nsubjpass |
blots,carried |
R2955 |
T4879 |
T4878 |
auxpass |
were,carried |
R2956 |
T4880 |
T4878 |
prt |
out,carried |
R2957 |
T4881 |
T4878 |
advcl |
Using,carried |
R2958 |
T4882 |
T4881 |
dobj |
ECL,Using |
R2959 |
T4883 |
T4884 |
punct |
(,PIERCE |
R296 |
T602 |
T600 |
compound |
gene,family |
R2960 |
T4884 |
T4882 |
parataxis |
PIERCE,ECL |
R2961 |
T4885 |
T4884 |
punct |
),PIERCE |
R2962 |
T4886 |
T4887 |
mark |
as,described |
R2963 |
T4887 |
T4878 |
advcl |
described,carried |
R2964 |
T4888 |
T4887 |
advmod |
previously,described |
R2965 |
T4889 |
T4890 |
punct |
[,1 |
R2966 |
T4890 |
T4878 |
parataxis |
1,carried |
R2967 |
T4891 |
T4890 |
punct |
],1 |
R2968 |
T4892 |
T4878 |
punct |
.,carried |
R2969 |
T4894 |
T4895 |
det |
The,membranes |
R297 |
T603 |
T600 |
acl |
named,family |
R2970 |
T4895 |
T4896 |
nsubjpass |
membranes,washed |
R2971 |
T4897 |
T4896 |
auxpass |
were,washed |
R2972 |
T4898 |
T4896 |
advmod |
extensively,washed |
R2973 |
T4899 |
T4896 |
prep |
after,washed |
R2974 |
T4900 |
T4899 |
pobj |
incubation,after |
R2975 |
T4901 |
T4900 |
prep |
with,incubation |
R2976 |
T4902 |
T4903 |
amod |
primary,antibodies |
R2977 |
T4903 |
T4901 |
pobj |
antibodies,with |
R2978 |
T4904 |
T4902 |
cc |
and,primary |
R2979 |
T4905 |
T4902 |
conj |
secondary,primary |
R298 |
T604 |
T605 |
amod |
ancient,protein |
R2980 |
T4906 |
T4896 |
cc |
and,washed |
R2981 |
T4907 |
T4908 |
auxpass |
were,developed |
R2982 |
T4908 |
T4896 |
conj |
developed,washed |
R2983 |
T4909 |
T4908 |
advmod |
then,developed |
R2984 |
T4910 |
T4908 |
prep |
with,developed |
R2985 |
T4911 |
T4912 |
compound |
X-ray,films |
R2986 |
T4912 |
T4910 |
pobj |
films,with |
R2987 |
T4913 |
T4912 |
prep |
with,films |
R2988 |
T4914 |
T4915 |
amod |
optimal,time |
R2989 |
T4915 |
T4913 |
pobj |
time,with |
R299 |
T605 |
T603 |
oprd |
protein,named |
R2990 |
T4916 |
T4915 |
compound |
exposure,time |
R2991 |
T4917 |
T4896 |
punct |
.,washed |
R2992 |
T4941 |
T4942 |
compound |
Chromosome,localization |
R2993 |
T4944 |
T4945 |
det |
The,panel |
R2994 |
T4945 |
T4950 |
nsubjpass |
panel,used |
R2995 |
T4946 |
T4945 |
compound |
T31,panel |
R2996 |
T4947 |
T4945 |
compound |
mouse,panel |
R2997 |
T4948 |
T4945 |
compound |
radiation,panel |
R2998 |
T4949 |
T4945 |
compound |
hybrid,panel |
R2999 |
T4951 |
T4945 |
prep |
from,panel |
R3 |
T219 |
T217 |
cc |
and,cloning |
R30 |
T251 |
T232 |
punct |
.,cloned |
R300 |
T606 |
T605 |
amod |
conserved,protein |
R3000 |
T4952 |
T4953 |
compound |
Research,Genetics |
R3001 |
T4953 |
T4951 |
pobj |
Genetics,from |
R3002 |
T4954 |
T4950 |
auxpass |
was,used |
R3003 |
T4955 |
T4956 |
aux |
to,map |
R3004 |
T4956 |
T4950 |
advcl |
map,used |
R3005 |
T4957 |
T4958 |
det |
the,location |
R3006 |
T4958 |
T4956 |
dobj |
location,map |
R3007 |
T4959 |
T4958 |
compound |
chromosome,location |
R3008 |
T4960 |
T4958 |
prep |
of,location |
R3009 |
T4961 |
T4962 |
det |
each,member |
R301 |
T607 |
T605 |
compound |
domain,protein |
R3010 |
T4962 |
T4960 |
pobj |
member,of |
R3011 |
T4963 |
T4962 |
compound |
Acdp,member |
R3012 |
T4964 |
T4950 |
punct |
.,used |
R3013 |
T4966 |
T4967 |
nsubjpass |
Primers,used |
R3014 |
T4968 |
T4966 |
prep |
from,Primers |
R3015 |
T4969 |
T4970 |
nummod |
3,UTR |
R3016 |
T4970 |
T4968 |
pobj |
UTR,from |
R3017 |
T4971 |
T4969 |
punct |
',3 |
R3018 |
T4972 |
T4970 |
prep |
of,UTR |
R3019 |
T4973 |
T4974 |
det |
each,member |
R302 |
T608 |
T605 |
punct |
(,protein |
R3020 |
T4974 |
T4972 |
pobj |
member,of |
R3021 |
T4975 |
T4974 |
compound |
Acdp,member |
R3022 |
T4976 |
T4967 |
auxpass |
were,used |
R3023 |
T4977 |
T4978 |
aux |
to,amplify |
R3024 |
T4978 |
T4967 |
advcl |
amplify,used |
R3025 |
T4979 |
T4980 |
det |
the,clones |
R3026 |
T4980 |
T4978 |
dobj |
clones,amplify |
R3027 |
T4981 |
T4980 |
nummod |
100,clones |
R3028 |
T4982 |
T4980 |
nmod |
radiation,clones |
R3029 |
T4983 |
T4980 |
amod |
hybrid,clones |
R303 |
T609 |
T605 |
appos |
ACDP,protein |
R3030 |
T4984 |
T4980 |
acl |
representing,clones |
R3031 |
T4985 |
T4986 |
det |
the,genome |
R3032 |
T4986 |
T4984 |
dobj |
genome,representing |
R3033 |
T4987 |
T4986 |
compound |
mouse,genome |
R3034 |
T4988 |
T4967 |
punct |
.,used |
R3035 |
T4990 |
T4991 |
det |
The,data |
R3036 |
T4991 |
T4992 |
nsubjpass |
data,submitted |
R3037 |
T4993 |
T4992 |
auxpass |
were,submitted |
R3038 |
T4994 |
T4992 |
prep |
to,submitted |
R3039 |
T4995 |
T4996 |
det |
the,Database |
R304 |
T610 |
T605 |
punct |
),protein |
R3040 |
T4996 |
T4994 |
pobj |
Database,to |
R3041 |
T4997 |
T4998 |
compound |
Jackson,Laboratory |
R3042 |
T4998 |
T4996 |
compound |
Laboratory,Database |
R3043 |
T4999 |
T5000 |
compound |
Mouse,Hybrid |
R3044 |
T5000 |
T4996 |
compound |
Hybrid,Database |
R3045 |
T5001 |
T5000 |
compound |
Radiation,Hybrid |
R3046 |
T5002 |
T4992 |
prep |
for,submitted |
R3047 |
T5003 |
T5002 |
pobj |
analysis,for |
R3048 |
T5004 |
T4992 |
punct |
.,submitted |
R3049 |
T5023 |
T5024 |
compound |
Sequence,analyses |
R305 |
T611 |
T612 |
dep |
which,encodes |
R3050 |
T5026 |
T5027 |
compound |
Sequence,assembly |
R3051 |
T5027 |
T5028 |
nsubjpass |
assembly,performed |
R3052 |
T5029 |
T5028 |
auxpass |
was,performed |
R3053 |
T5030 |
T5028 |
prep |
with,performed |
R3054 |
T5031 |
T5032 |
compound |
program,Sequencher |
R3055 |
T5032 |
T5030 |
pobj |
Sequencher,with |
R3056 |
T5033 |
T5034 |
punct |
(,Corp |
R3057 |
T5034 |
T5032 |
parataxis |
Corp,Sequencher |
R3058 |
T5035 |
T5034 |
compound |
Gene,Corp |
R3059 |
T5036 |
T5034 |
compound |
Codes,Corp |
R306 |
T612 |
T600 |
relcl |
encodes,family |
R3060 |
T5037 |
T5034 |
punct |
),Corp |
R3061 |
T5038 |
T5028 |
punct |
.,performed |
R3062 |
T5040 |
T5041 |
nmod |
Protein,homology |
R3063 |
T5041 |
T5044 |
compound |
homology,searches |
R3064 |
T5042 |
T5040 |
cc |
and,Protein |
R3065 |
T5043 |
T5040 |
conj |
DNA,Protein |
R3066 |
T5044 |
T5045 |
nsubjpass |
searches,carried |
R3067 |
T5046 |
T5045 |
auxpass |
were,carried |
R3068 |
T5047 |
T5045 |
prt |
out,carried |
R3069 |
T5048 |
T5045 |
prep |
with,carried |
R307 |
T613 |
T614 |
nummod |
four,members |
R3070 |
T5049 |
T5050 |
nmod |
tblastn,programs |
R3071 |
T5050 |
T5048 |
pobj |
programs,with |
R3072 |
T5051 |
T5049 |
punct |
", ",tblastn |
R3073 |
T5052 |
T5049 |
conj |
tblastx,tblastn |
R3074 |
T5053 |
T5052 |
punct |
", ",tblastx |
R3075 |
T5054 |
T5052 |
conj |
blastp,tblastx |
R3076 |
T5055 |
T5054 |
cc |
and,blastp |
R3077 |
T5056 |
T5054 |
conj |
blastn,blastp |
R3078 |
T5057 |
T5045 |
punct |
.,carried |
R3079 |
T5059 |
T5060 |
amod |
Multiple,alignments |
R308 |
T614 |
T612 |
dobj |
members,encodes |
R3080 |
T5060 |
T5062 |
nsubjpass |
alignments,performed |
R3081 |
T5061 |
T5060 |
compound |
sequence,alignments |
R3082 |
T5063 |
T5062 |
auxpass |
were,performed |
R3083 |
T5064 |
T5062 |
prep |
with,performed |
R3084 |
T5065 |
T5066 |
nmod |
GeneDoc,alignment |
R3085 |
T5066 |
T5064 |
pobj |
alignment,with |
R3086 |
T5067 |
T5065 |
cc |
and,GeneDoc |
R3087 |
T5068 |
T5065 |
conj |
pairwise,GeneDoc |
R3088 |
T5069 |
T5066 |
compound |
sequence,alignment |
R3089 |
T5070 |
T5062 |
punct |
.,performed |
R309 |
T615 |
T614 |
compound |
protein,members |
R3090 |
T5072 |
T5073 |
amod |
Multiple,programs |
R3091 |
T5073 |
T5074 |
nsubjpass |
programs,used |
R3092 |
T5075 |
T5073 |
prep |
including,programs |
R3093 |
T5076 |
T5077 |
compound |
BCM,Launcher |
R3094 |
T5077 |
T5075 |
pobj |
Launcher,including |
R3095 |
T5078 |
T5077 |
compound |
Search,Launcher |
R3096 |
T5079 |
T5077 |
punct |
", ",Launcher |
R3097 |
T5080 |
T5077 |
conj |
ProfileScan,Launcher |
R3098 |
T5081 |
T5080 |
punct |
", ",ProfileScan |
R3099 |
T5082 |
T5083 |
compound |
sequence,search |
R31 |
T253 |
T254 |
aux |
To,facilitate |
R310 |
T616 |
T612 |
prep |
in,encodes |
R3100 |
T5083 |
T5080 |
conj |
search,ProfileScan |
R3101 |
T5084 |
T5083 |
compound |
motif,search |
R3102 |
T5085 |
T5083 |
punct |
", ",search |
R3103 |
T5086 |
T5083 |
conj |
ExPASy,search |
R3104 |
T5087 |
T5086 |
cc |
and,ExPASy |
R3105 |
T5088 |
T5086 |
conj |
3Dpssm,ExPASy |
R3106 |
T5089 |
T5074 |
auxpass |
were,used |
R3107 |
T5090 |
T5074 |
prep |
for,used |
R3108 |
T5091 |
T5090 |
pcomp |
searching,for |
R3109 |
T5092 |
T5093 |
compound |
sequence,features |
R311 |
T617 |
T616 |
pobj |
humans,in |
R3110 |
T5093 |
T5091 |
dobj |
features,searching |
R3111 |
T5094 |
T5093 |
prep |
of,features |
R3112 |
T5095 |
T5096 |
amod |
known,protein |
R3113 |
T5096 |
T5094 |
pobj |
protein,of |
R3114 |
T5097 |
T5074 |
punct |
.,used |
R3115 |
T5099 |
T5100 |
amod |
Phylogenetic,tree |
R3116 |
T5100 |
T5101 |
nsubjpass |
tree,constructed |
R3117 |
T5102 |
T5101 |
auxpass |
was,constructed |
R3118 |
T5103 |
T5101 |
agent |
by,constructed |
R3119 |
T5104 |
T5105 |
compound |
Clustalw,program |
R312 |
T618 |
T619 |
punct |
[,1 |
R3120 |
T5105 |
T5103 |
pobj |
program,by |
R3121 |
T5106 |
T5107 |
punct |
(,version |
R3122 |
T5107 |
T5105 |
parataxis |
version,program |
R3123 |
T5108 |
T5107 |
nummod |
1.81,version |
R3124 |
T5109 |
T5107 |
punct |
),version |
R3125 |
T5110 |
T5101 |
advcl |
using,constructed |
R3126 |
T5111 |
T5112 |
nmod |
UPGMA,algorithm |
R3127 |
T5112 |
T5110 |
dobj |
algorithm,using |
R3128 |
T5113 |
T5111 |
punct |
(,UPGMA |
R3129 |
T5114 |
T5115 |
amod |
Unweighted,Method |
R313 |
T619 |
T598 |
parataxis |
1,characterized |
R3130 |
T5115 |
T5111 |
appos |
Method,UPGMA |
R3131 |
T5116 |
T5115 |
compound |
Pair,Method |
R3132 |
T5117 |
T5115 |
compound |
Group,Method |
R3133 |
T5118 |
T5115 |
acl |
using,Method |
R3134 |
T5119 |
T5120 |
compound |
Arithmetic,averages |
R3135 |
T5120 |
T5118 |
dobj |
averages,using |
R3136 |
T5121 |
T5112 |
punct |
),algorithm |
R3137 |
T5122 |
T5123 |
punct |
[,14 |
R3138 |
T5123 |
T5101 |
parataxis |
14,constructed |
R3139 |
T5124 |
T5123 |
punct |
],14 |
R314 |
T620 |
T619 |
punct |
],1 |
R3140 |
T5125 |
T5101 |
punct |
.,constructed |
R3141 |
T5264 |
T5265 |
amod |
Neuronal,preparation |
R3142 |
T5266 |
T5265 |
compound |
cell,preparation |
R3143 |
T5267 |
T5265 |
cc |
and,preparation |
R3144 |
T5268 |
T5265 |
conj |
immunostanining,preparation |
R3145 |
T5270 |
T5271 |
amod |
Hippocampal,cultures |
R3146 |
T5271 |
T5273 |
nsubjpass |
cultures,prepared |
R3147 |
T5272 |
T5271 |
compound |
neuron,cultures |
R3148 |
T5274 |
T5273 |
auxpass |
were,prepared |
R3149 |
T5275 |
T5276 |
mark |
as,reported |
R315 |
T621 |
T594 |
punct |
.,cloned |
R3150 |
T5276 |
T5273 |
advcl |
reported,prepared |
R3151 |
T5277 |
T5276 |
advmod |
previously,reported |
R3152 |
T5278 |
T5279 |
punct |
[,6 |
R3153 |
T5279 |
T5273 |
parataxis |
6,prepared |
R3154 |
T5280 |
T5279 |
punct |
],6 |
R3155 |
T5281 |
T5273 |
punct |
.,prepared |
R3156 |
T5283 |
T5284 |
prep |
In,dissected |
R3157 |
T5285 |
T5283 |
pobj |
brief,In |
R3158 |
T5286 |
T5284 |
punct |
", ",dissected |
R3159 |
T5287 |
T5288 |
det |
the,hippocampuses |
R316 |
T623 |
T624 |
nsubj |
We,found |
R3160 |
T5288 |
T5284 |
nsubjpass |
hippocampuses,dissected |
R3161 |
T5289 |
T5284 |
auxpass |
were,dissected |
R3162 |
T5290 |
T5284 |
prt |
out,dissected |
R3163 |
T5291 |
T5284 |
prep |
from,dissected |
R3164 |
T5292 |
T5293 |
compound |
mouse,embryos |
R3165 |
T5293 |
T5291 |
pobj |
embryos,from |
R3166 |
T5294 |
T5284 |
prep |
at,dissected |
R3167 |
T5295 |
T5296 |
nummod |
16,days |
R3168 |
T5296 |
T5294 |
pobj |
days,at |
R3169 |
T5297 |
T5298 |
advmod |
in,utero |
R317 |
T625 |
T626 |
mark |
that,is |
R3170 |
T5298 |
T5296 |
advmod |
utero,days |
R3171 |
T5299 |
T5284 |
punct |
.,dissected |
R3172 |
T5301 |
T5302 |
det |
The,tissues |
R3173 |
T5302 |
T5303 |
nsubjpass |
tissues,incubated |
R3174 |
T5304 |
T5303 |
auxpass |
were,incubated |
R3175 |
T5305 |
T5303 |
advmod |
then,incubated |
R3176 |
T5306 |
T5303 |
prep |
for,incubated |
R3177 |
T5307 |
T5308 |
nummod |
20,min |
R3178 |
T5308 |
T5306 |
pobj |
min,for |
R3179 |
T5309 |
T5303 |
prep |
at,incubated |
R318 |
T626 |
T624 |
ccomp |
is,found |
R3180 |
T5310 |
T5311 |
nummod |
37,°C |
R3181 |
T5311 |
T5309 |
pobj |
°C,at |
R3182 |
T5312 |
T5303 |
prep |
in,incubated |
R3183 |
T5313 |
T5312 |
pobj |
MEM,in |
R3184 |
T5314 |
T5313 |
punct |
(,MEM |
R3185 |
T5315 |
T5316 |
amod |
minimum,medium |
R3186 |
T5316 |
T5313 |
appos |
medium,MEM |
R3187 |
T5317 |
T5316 |
amod |
essential,medium |
R3188 |
T5318 |
T5313 |
punct |
),MEM |
R3189 |
T5319 |
T5313 |
acl |
modified,MEM |
R319 |
T627 |
T628 |
det |
this,family |
R3190 |
T5320 |
T5319 |
prep |
for,modified |
R3191 |
T5321 |
T5322 |
compound |
suspension,culture |
R3192 |
T5322 |
T5320 |
pobj |
culture,for |
R3193 |
T5323 |
T5324 |
punct |
(,Technologies |
R3194 |
T5324 |
T5313 |
parataxis |
Technologies,MEM |
R3195 |
T5325 |
T5324 |
compound |
Life,Technologies |
R3196 |
T5326 |
T5324 |
punct |
),Technologies |
R3197 |
T5327 |
T5313 |
cc |
plus,MEM |
R3198 |
T5328 |
T5329 |
nummod |
0.25,% |
R3199 |
T5329 |
T5330 |
compound |
%,trypsin |
R32 |
T254 |
T255 |
advcl |
facilitate,cloned |
R320 |
T628 |
T626 |
nsubj |
family,is |
R3200 |
T5330 |
T5313 |
conj |
trypsin,MEM |
R3201 |
T5331 |
T5332 |
punct |
(,Technologies |
R3202 |
T5332 |
T5330 |
parataxis |
Technologies,trypsin |
R3203 |
T5333 |
T5332 |
compound |
Life,Technologies |
R3204 |
T5334 |
T5332 |
punct |
),Technologies |
R3205 |
T5335 |
T5303 |
punct |
.,incubated |
R3206 |
T5337 |
T5338 |
det |
The,neurons |
R3207 |
T5338 |
T5341 |
nsubjpass |
neurons,plated |
R3208 |
T5339 |
T5338 |
amod |
dissociated,neurons |
R3209 |
T5340 |
T5338 |
amod |
hippocampal,neurons |
R321 |
T629 |
T628 |
compound |
gene,family |
R3210 |
T5342 |
T5341 |
auxpass |
were,plated |
R3211 |
T5343 |
T5341 |
prep |
on,plated |
R3212 |
T5344 |
T5345 |
compound |
glass,coverslips |
R3213 |
T5345 |
T5343 |
pobj |
coverslips,on |
R3214 |
T5346 |
T5345 |
acl |
coated,coverslips |
R3215 |
T5347 |
T5346 |
prep |
with,coated |
R3216 |
T5348 |
T5349 |
det |
a,monolayer |
R3217 |
T5349 |
T5347 |
pobj |
monolayer,with |
R3218 |
T5350 |
T5349 |
amod |
confluent,monolayer |
R3219 |
T5351 |
T5349 |
prep |
of,monolayer |
R322 |
T630 |
T631 |
advmod |
evolutionarily,conserved |
R3220 |
T5352 |
T5353 |
nmod |
mouse,astrocytes |
R3221 |
T5353 |
T5351 |
pobj |
astrocytes,of |
R3222 |
T5354 |
T5353 |
amod |
cortical,astrocytes |
R3223 |
T5355 |
T5353 |
acl |
obtained,astrocytes |
R3224 |
T5356 |
T5357 |
mark |
as,described |
R3225 |
T5357 |
T5355 |
advcl |
described,obtained |
R3226 |
T5358 |
T5357 |
advmod |
below,described |
R3227 |
T5359 |
T5341 |
punct |
.,plated |
R3228 |
T5361 |
T5362 |
det |
The,neurons |
R3229 |
T5362 |
T5363 |
nsubjpass |
neurons,maintained |
R323 |
T631 |
T626 |
acomp |
conserved,is |
R3230 |
T5364 |
T5363 |
auxpass |
were,maintained |
R3231 |
T5365 |
T5363 |
prep |
at,maintained |
R3232 |
T5366 |
T5367 |
nummod |
37,°C |
R3233 |
T5367 |
T5365 |
pobj |
°C,at |
R3234 |
T5368 |
T5363 |
prep |
in,maintained |
R3235 |
T5369 |
T5370 |
det |
a,atmosphere |
R3236 |
T5370 |
T5368 |
pobj |
atmosphere,in |
R3237 |
T5371 |
T5370 |
amod |
humidified,atmosphere |
R3238 |
T5372 |
T5370 |
prep |
with,atmosphere |
R3239 |
T5373 |
T5374 |
nummod |
5,% |
R324 |
T632 |
T626 |
prep |
in,is |
R3240 |
T5374 |
T5375 |
compound |
%,CO2 |
R3241 |
T5375 |
T5372 |
pobj |
CO2,with |
R3242 |
T5376 |
T5363 |
punct |
.,maintained |
R3243 |
T5378 |
T5379 |
amod |
Cortical,astrocytes |
R3244 |
T5379 |
T5380 |
nsubjpass |
astrocytes,grown |
R3245 |
T5381 |
T5379 |
acl |
dissociated,astrocytes |
R3246 |
T5382 |
T5381 |
prep |
from,dissociated |
R3247 |
T5383 |
T5384 |
amod |
newborn,mouse |
R3248 |
T5384 |
T5385 |
compound |
mouse,cortices |
R3249 |
T5385 |
T5382 |
pobj |
cortices,from |
R325 |
T633 |
T634 |
amod |
diverse,species |
R3250 |
T5386 |
T5380 |
auxpass |
were,grown |
R3251 |
T5387 |
T5380 |
prep |
in,grown |
R3252 |
T5388 |
T5389 |
compound |
culture,flasks |
R3253 |
T5389 |
T5387 |
pobj |
flasks,in |
R3254 |
T5390 |
T5380 |
prep |
at,grown |
R3255 |
T5391 |
T5392 |
nummod |
37,°C |
R3256 |
T5392 |
T5390 |
pobj |
°C,at |
R3257 |
T5393 |
T5380 |
prep |
in,grown |
R3258 |
T5394 |
T5395 |
det |
a,atmosphere |
R3259 |
T5395 |
T5393 |
pobj |
atmosphere,in |
R326 |
T634 |
T632 |
pobj |
species,in |
R3260 |
T5396 |
T5395 |
amod |
humidified,atmosphere |
R3261 |
T5397 |
T5395 |
prep |
with,atmosphere |
R3262 |
T5398 |
T5399 |
nummod |
5,% |
R3263 |
T5399 |
T5400 |
compound |
%,CO2 |
R3264 |
T5400 |
T5397 |
pobj |
CO2,with |
R3265 |
T5401 |
T5380 |
prep |
until,grown |
R3266 |
T5402 |
T5401 |
pcomp |
confluent,until |
R3267 |
T5403 |
T5380 |
punct |
.,grown |
R3268 |
T5405 |
T5406 |
det |
The,cells |
R3269 |
T5406 |
T5407 |
nsubjpass |
cells,exposed |
R327 |
T635 |
T634 |
acl |
ranging,species |
R3270 |
T5408 |
T5407 |
auxpass |
were,exposed |
R3271 |
T5409 |
T5407 |
prep |
to,exposed |
R3272 |
T5410 |
T5411 |
quantmod |
10,5 |
R3273 |
T5411 |
T5413 |
nummod |
5,M |
R3274 |
T5412 |
T5411 |
punct |
-,5 |
R3275 |
T5413 |
T5414 |
compound |
M,arabinoside |
R3276 |
T5414 |
T5409 |
pobj |
arabinoside,to |
R3277 |
T5415 |
T5414 |
compound |
cytosine,arabinoside |
R3278 |
T5416 |
T5417 |
punct |
(,Sigma |
R3279 |
T5417 |
T5414 |
parataxis |
Sigma,arabinoside |
R328 |
T636 |
T635 |
prep |
from,ranging |
R3280 |
T5418 |
T5417 |
punct |
),Sigma |
R3281 |
T5419 |
T5407 |
cc |
and,exposed |
R3282 |
T5420 |
T5407 |
conj |
cultured,exposed |
R3283 |
T5421 |
T5420 |
prep |
for,cultured |
R3284 |
T5422 |
T5423 |
amod |
additional,hrs |
R3285 |
T5423 |
T5421 |
pobj |
hrs,for |
R3286 |
T5424 |
T5425 |
quantmod |
12,24 |
R3287 |
T5425 |
T5423 |
nummod |
24,hrs |
R3288 |
T5426 |
T5425 |
punct |
–,24 |
R3289 |
T5427 |
T5420 |
prep |
at,cultured |
R329 |
T637 |
T636 |
pobj |
bacteria,from |
R3290 |
T5428 |
T5429 |
nummod |
37,°C |
R3291 |
T5429 |
T5427 |
pobj |
°C,at |
R3292 |
T5430 |
T5407 |
punct |
.,exposed |
R3293 |
T5432 |
T5433 |
prep |
After,used |
R3294 |
T5434 |
T5432 |
pobj |
remove,After |
R3295 |
T5435 |
T5434 |
prep |
of,remove |
R3296 |
T5436 |
T5437 |
det |
the,media |
R3297 |
T5437 |
T5435 |
pobj |
media,of |
R3298 |
T5438 |
T5434 |
prep |
with,remove |
R3299 |
T5439 |
T5440 |
amod |
cellular,debris |
R33 |
T256 |
T257 |
det |
the,study |
R330 |
T638 |
T637 |
punct |
", ",bacteria |
R3300 |
T5440 |
T5438 |
pobj |
debris,with |
R3301 |
T5441 |
T5433 |
punct |
", ",used |
R3302 |
T5442 |
T5443 |
det |
the,cells |
R3303 |
T5443 |
T5433 |
nsubjpass |
cells,used |
R3304 |
T5444 |
T5433 |
auxpass |
were,used |
R3305 |
T5445 |
T5433 |
prep |
for,used |
R3306 |
T5446 |
T5445 |
pcomp |
coating,for |
R3307 |
T5447 |
T5446 |
dobj |
coverslips,coating |
R3308 |
T5448 |
T5433 |
punct |
.,used |
R3309 |
T5450 |
T5451 |
prep |
For,fixed |
R331 |
T639 |
T637 |
conj |
yeast,bacteria |
R3310 |
T5452 |
T5450 |
pobj |
immunostaining,For |
R3311 |
T5453 |
T5451 |
punct |
", ",fixed |
R3312 |
T5454 |
T5455 |
amod |
neuronal,cells |
R3313 |
T5455 |
T5451 |
nsubjpass |
cells,fixed |
R3314 |
T5456 |
T5455 |
prep |
on,cells |
R3315 |
T5457 |
T5458 |
det |
the,coverslips |
R3316 |
T5458 |
T5456 |
pobj |
coverslips,on |
R3317 |
T5459 |
T5451 |
auxpass |
were,fixed |
R3318 |
T5460 |
T5451 |
advmod |
first,fixed |
R3319 |
T5461 |
T5451 |
prep |
in,fixed |
R332 |
T640 |
T639 |
punct |
", ",yeast |
R3320 |
T5462 |
T5461 |
pobj |
PBS,in |
R3321 |
T5463 |
T5462 |
acl |
containing,PBS |
R3322 |
T5464 |
T5465 |
nummod |
4,% |
R3323 |
T5465 |
T5466 |
compound |
%,paraformaldehyde |
R3324 |
T5466 |
T5463 |
dobj |
paraformaldehyde,containing |
R3325 |
T5467 |
T5466 |
punct |
(,paraformaldehyde |
R3326 |
T5468 |
T5466 |
appos |
PFA,paraformaldehyde |
R3327 |
T5469 |
T5463 |
punct |
),containing |
R3328 |
T5470 |
T5463 |
prep |
for,containing |
R3329 |
T5471 |
T5472 |
nummod |
12,hrs |
R333 |
T641 |
T642 |
compound |
C.,elegans |
R3330 |
T5472 |
T5470 |
pobj |
hrs,for |
R3331 |
T5473 |
T5463 |
prep |
at,containing |
R3332 |
T5474 |
T5475 |
nummod |
4,°C |
R3333 |
T5475 |
T5473 |
pobj |
°C,at |
R3334 |
T5476 |
T5451 |
cc |
and,fixed |
R3335 |
T5477 |
T5478 |
advmod |
then,incubated |
R3336 |
T5478 |
T5451 |
conj |
incubated,fixed |
R3337 |
T5479 |
T5478 |
prep |
in,incubated |
R3338 |
T5480 |
T5481 |
det |
a,solution |
R3339 |
T5481 |
T5479 |
pobj |
solution,in |
R334 |
T642 |
T639 |
conj |
elegans,yeast |
R3340 |
T5482 |
T5481 |
acl |
containing,solution |
R3341 |
T5483 |
T5484 |
nummod |
4,% |
R3342 |
T5484 |
T5485 |
compound |
%,PFA |
R3343 |
T5485 |
T5482 |
dobj |
PFA,containing |
R3344 |
T5486 |
T5485 |
cc |
and,PFA |
R3345 |
T5487 |
T5488 |
nummod |
0.4,% |
R3346 |
T5488 |
T5489 |
compound |
%,100 |
R3347 |
T5489 |
T5485 |
conj |
100,PFA |
R3348 |
T5490 |
T5489 |
compound |
Triton,100 |
R3349 |
T5491 |
T5489 |
compound |
X,100 |
R335 |
T643 |
T642 |
punct |
", ",elegans |
R3350 |
T5492 |
T5489 |
punct |
-,100 |
R3351 |
T5493 |
T5478 |
prep |
at,incubated |
R3352 |
T5494 |
T5495 |
nummod |
4,°C |
R3353 |
T5495 |
T5493 |
pobj |
°C,at |
R3354 |
T5496 |
T5478 |
prep |
for,incubated |
R3355 |
T5497 |
T5498 |
nummod |
1,hr |
R3356 |
T5498 |
T5496 |
pobj |
hr,for |
R3357 |
T5499 |
T5451 |
punct |
.,fixed |
R3358 |
T5501 |
T5502 |
prep |
After,incubated |
R3359 |
T5503 |
T5501 |
pcomp |
washing,After |
R336 |
T644 |
T642 |
cc |
and,elegans |
R3360 |
T5504 |
T5503 |
prep |
with,washing |
R3361 |
T5505 |
T5504 |
pobj |
PBS,with |
R3362 |
T5506 |
T5507 |
nummod |
three,times |
R3363 |
T5507 |
T5503 |
npadvmod |
times,washing |
R3364 |
T5508 |
T5502 |
punct |
", ",incubated |
R3365 |
T5509 |
T5510 |
det |
the,cells |
R3366 |
T5510 |
T5502 |
nsubjpass |
cells,incubated |
R3367 |
T5511 |
T5502 |
auxpass |
were,incubated |
R3368 |
T5512 |
T5502 |
prep |
with,incubated |
R3369 |
T5513 |
T5514 |
det |
a,solution |
R337 |
T645 |
T646 |
compound |
D.,melanogaster |
R3370 |
T5514 |
T5512 |
pobj |
solution,with |
R3371 |
T5515 |
T5514 |
amod |
blocking,solution |
R3372 |
T5516 |
T5514 |
acl |
containing,solution |
R3373 |
T5517 |
T5518 |
nummod |
1,serum |
R3374 |
T5518 |
T5516 |
dobj |
serum,containing |
R3375 |
T5519 |
T5520 |
punct |
:,30 |
R3376 |
T5520 |
T5517 |
prep |
30,1 |
R3377 |
T5521 |
T5518 |
amod |
normal,serum |
R3378 |
T5522 |
T5518 |
compound |
goat,serum |
R3379 |
T5523 |
T5502 |
punct |
", ",incubated |
R338 |
T646 |
T642 |
conj |
melanogaster,elegans |
R3380 |
T5524 |
T5502 |
cc |
and,incubated |
R3381 |
T5525 |
T5526 |
advmod |
subsequently,incubated |
R3382 |
T5526 |
T5502 |
conj |
incubated,incubated |
R3383 |
T5527 |
T5526 |
prep |
with,incubated |
R3384 |
T5528 |
T5529 |
det |
a,antibody |
R3385 |
T5529 |
T5527 |
pobj |
antibody,with |
R3386 |
T5530 |
T5529 |
nmod |
rabbit,antibody |
R3387 |
T5531 |
T5529 |
amod |
polyclonal,antibody |
R3388 |
T5532 |
T5529 |
amod |
anti-ACDP,antibody |
R3389 |
T5533 |
T5534 |
punct |
(,1 |
R339 |
T647 |
T636 |
prep |
to,from |
R3390 |
T5534 |
T5529 |
parataxis |
1,antibody |
R3391 |
T5535 |
T5536 |
punct |
:,3000 |
R3392 |
T5536 |
T5534 |
prep |
3000,1 |
R3393 |
T5537 |
T5534 |
punct |
),1 |
R3394 |
T5538 |
T5526 |
advmod |
overnight,incubated |
R3395 |
T5539 |
T5526 |
prep |
at,incubated |
R3396 |
T5540 |
T5541 |
nummod |
4,°C |
R3397 |
T5541 |
T5539 |
pobj |
°C,at |
R3398 |
T5542 |
T5502 |
punct |
.,incubated |
R3399 |
T5544 |
T5545 |
prep |
After,incubated |
R34 |
T257 |
T254 |
dobj |
study,facilitate |
R340 |
T648 |
T647 |
pobj |
mammals,to |
R3400 |
T5546 |
T5547 |
amod |
extensive,washing |
R3401 |
T5547 |
T5544 |
pobj |
washing,After |
R3402 |
T5548 |
T5547 |
prep |
with,washing |
R3403 |
T5549 |
T5550 |
nummod |
1,% |
R3404 |
T5550 |
T5551 |
compound |
%,serum |
R3405 |
T5551 |
T5553 |
compound |
serum,solution |
R3406 |
T5552 |
T5551 |
compound |
goat,serum |
R3407 |
T5553 |
T5548 |
pobj |
solution,with |
R3408 |
T5554 |
T5553 |
compound |
PBS,solution |
R3409 |
T5555 |
T5545 |
punct |
", ",incubated |
R341 |
T649 |
T624 |
punct |
.,found |
R3410 |
T5556 |
T5557 |
det |
the,cells |
R3411 |
T5557 |
T5545 |
nsubjpass |
cells,incubated |
R3412 |
T5558 |
T5545 |
auxpass |
were,incubated |
R3413 |
T5559 |
T5545 |
prep |
with,incubated |
R3414 |
T5560 |
T5561 |
det |
an,antibody |
R3415 |
T5561 |
T5559 |
pobj |
antibody,with |
R3416 |
T5562 |
T5561 |
nmod |
Alex,antibody |
R3417 |
T5563 |
T5562 |
nummod |
488,Alex |
R3418 |
T5564 |
T5561 |
amod |
conjugated,antibody |
R3419 |
T5565 |
T5561 |
amod |
secondary,antibody |
R342 |
T651 |
T652 |
det |
The,conservation |
R3420 |
T5566 |
T5567 |
punct |
(,Probes |
R3421 |
T5567 |
T5561 |
parataxis |
Probes,antibody |
R3422 |
T5568 |
T5567 |
dep |
1,Probes |
R3423 |
T5569 |
T5570 |
punct |
:,100 |
R3424 |
T5570 |
T5568 |
prep |
100,1 |
R3425 |
T5571 |
T5568 |
prep |
in,1 |
R3426 |
T5572 |
T5573 |
nummod |
1,% |
R3427 |
T5573 |
T5574 |
compound |
%,serum |
R3428 |
T5574 |
T5576 |
compound |
serum,solution |
R3429 |
T5575 |
T5574 |
compound |
goat,serum |
R343 |
T652 |
T654 |
nsubj |
conservation,imply |
R3430 |
T5576 |
T5571 |
pobj |
solution,in |
R3431 |
T5577 |
T5576 |
compound |
PBS,solution |
R3432 |
T5578 |
T5567 |
punct |
", ",Probes |
R3433 |
T5579 |
T5567 |
compound |
Molecular,Probes |
R3434 |
T5580 |
T5567 |
punct |
),Probes |
R3435 |
T5581 |
T5545 |
prep |
for,incubated |
R3436 |
T5582 |
T5583 |
nummod |
3,hrs |
R3437 |
T5583 |
T5581 |
pobj |
hrs,for |
R3438 |
T5584 |
T5545 |
prep |
at,incubated |
R3439 |
T5585 |
T5586 |
compound |
room,temperature |
R344 |
T653 |
T652 |
compound |
sequence,conservation |
R3440 |
T5586 |
T5584 |
pobj |
temperature,at |
R3441 |
T5587 |
T5545 |
punct |
.,incubated |
R3442 |
T5589 |
T5590 |
prep |
Following,slipped |
R3443 |
T5591 |
T5592 |
amod |
final,washes |
R3444 |
T5592 |
T5589 |
pobj |
washes,Following |
R3445 |
T5593 |
T5592 |
prep |
with,washes |
R3446 |
T5594 |
T5595 |
nummod |
1,% |
R3447 |
T5595 |
T5596 |
compound |
%,serum |
R3448 |
T5596 |
T5598 |
compound |
serum,solution |
R3449 |
T5597 |
T5596 |
compound |
goat,serum |
R345 |
T655 |
T652 |
cc |
and,conservation |
R3450 |
T5598 |
T5593 |
pobj |
solution,with |
R3451 |
T5599 |
T5598 |
compound |
PBS,solution |
R3452 |
T5600 |
T5590 |
punct |
", ",slipped |
R3453 |
T5601 |
T5602 |
det |
the,cells |
R3454 |
T5602 |
T5590 |
nsubjpass |
cells,slipped |
R3455 |
T5603 |
T5602 |
amod |
neuronal,cells |
R3456 |
T5604 |
T5602 |
prep |
on,cells |
R3457 |
T5605 |
T5606 |
det |
the,coverslips |
R3458 |
T5606 |
T5604 |
pobj |
coverslips,on |
R3459 |
T5607 |
T5590 |
auxpass |
were,slipped |
R346 |
T656 |
T657 |
det |
the,presence |
R3460 |
T5608 |
T5590 |
dep |
cover,slipped |
R3461 |
T5609 |
T5590 |
punct |
-,slipped |
R3462 |
T5610 |
T5590 |
prep |
with,slipped |
R3463 |
T5611 |
T5612 |
det |
a,medium |
R3464 |
T5612 |
T5610 |
pobj |
medium,with |
R3465 |
T5613 |
T5614 |
npadvmod |
glycerol,based |
R3466 |
T5614 |
T5612 |
amod |
based,medium |
R3467 |
T5615 |
T5614 |
punct |
-,based |
R3468 |
T5616 |
T5612 |
amod |
anti-photobleach,medium |
R3469 |
T5617 |
T5590 |
punct |
.,slipped |
R347 |
T657 |
T652 |
conj |
presence,conservation |
R3470 |
T5619 |
T5620 |
det |
The,cells |
R3471 |
T5620 |
T5621 |
nsubjpass |
cells,viewed |
R3472 |
T5622 |
T5621 |
auxpass |
were,viewed |
R3473 |
T5623 |
T5621 |
prep |
under,viewed |
R3474 |
T5624 |
T5625 |
det |
a,microscope |
R3475 |
T5625 |
T5623 |
pobj |
microscope,under |
R3476 |
T5626 |
T5625 |
amod |
confocal,microscope |
R3477 |
T5627 |
T5628 |
punct |
(,Zeiss |
R3478 |
T5628 |
T5625 |
parataxis |
Zeiss,microscope |
R3479 |
T5629 |
T5628 |
compound |
Carl,Zeiss |
R348 |
T658 |
T657 |
prep |
of,presence |
R3480 |
T5630 |
T5628 |
punct |
),Zeiss |
R3481 |
T5631 |
T5621 |
punct |
.,viewed |
R3482 |
T5633 |
T5634 |
nsubjpass |
Images,captured |
R3483 |
T5635 |
T5634 |
auxpass |
were,captured |
R3484 |
T5636 |
T5634 |
prep |
with,captured |
R3485 |
T5637 |
T5638 |
det |
a,camera |
R3486 |
T5638 |
T5636 |
pobj |
camera,with |
R3487 |
T5639 |
T5638 |
compound |
CCD,camera |
R3488 |
T5640 |
T5634 |
cc |
and,captured |
R3489 |
T5641 |
T5634 |
conj |
acquired,captured |
R349 |
T659 |
T660 |
amod |
multiple,members |
R3490 |
T5642 |
T5641 |
prep |
by,acquired |
R3491 |
T5643 |
T5644 |
det |
the,software |
R3492 |
T5644 |
T5642 |
pobj |
software,by |
R3493 |
T5645 |
T5644 |
compound |
Scion,software |
R3494 |
T5646 |
T5644 |
compound |
Image,software |
R3495 |
T5647 |
T5648 |
punct |
(,Corporation |
R3496 |
T5648 |
T5644 |
parataxis |
Corporation,software |
R3497 |
T5649 |
T5648 |
compound |
Scion,Corporation |
R3498 |
T5650 |
T5648 |
punct |
", ",Corporation |
R3499 |
T5651 |
T5648 |
npadvmod |
Frederick,Corporation |
R35 |
T258 |
T257 |
amod |
functional,study |
R350 |
T660 |
T658 |
pobj |
members,of |
R3500 |
T5652 |
T5648 |
punct |
", ",Corporation |
R3501 |
T5653 |
T5648 |
npadvmod |
MD,Corporation |
R3502 |
T5654 |
T5648 |
punct |
),Corporation |
R3503 |
T5655 |
T5634 |
punct |
.,captured |
R3504 |
T5677 |
T5678 |
compound |
Gene,bank |
R3505 |
T5678 |
T5679 |
compound |
bank,number |
R3506 |
T5680 |
T5679 |
compound |
accession,number |
R3507 |
T5682 |
T5683 |
det |
The,sequences |
R3508 |
T5683 |
T5685 |
nsubjpass |
sequences,deposited |
R3509 |
T5684 |
T5683 |
compound |
cDNA,sequences |
R351 |
T661 |
T657 |
prep |
within,presence |
R3510 |
T5686 |
T5683 |
prep |
for,sequences |
R3511 |
T5687 |
T5688 |
det |
the,family |
R3512 |
T5688 |
T5686 |
pobj |
family,for |
R3513 |
T5689 |
T5688 |
compound |
Acdp,family |
R3514 |
T5690 |
T5688 |
compound |
gene,family |
R3515 |
T5691 |
T5685 |
aux |
have,deposited |
R3516 |
T5692 |
T5685 |
advmod |
already,deposited |
R3517 |
T5693 |
T5685 |
auxpass |
been,deposited |
R3518 |
T5694 |
T5685 |
prep |
in,deposited |
R3519 |
T5695 |
T5696 |
compound |
gene,bank |
R352 |
T662 |
T663 |
det |
a,species |
R3520 |
T5696 |
T5694 |
pobj |
bank,in |
R3521 |
T5697 |
T5685 |
prep |
with,deposited |
R3522 |
T5698 |
T5699 |
compound |
accession,AF202994 |
R3523 |
T5699 |
T5697 |
pobj |
AF202994,with |
R3524 |
T5700 |
T5699 |
compound |
numbers,AF202994 |
R3525 |
T5701 |
T5699 |
punct |
(,AF202994 |
R3526 |
T5702 |
T5699 |
appos |
Acdp1,AF202994 |
R3527 |
T5703 |
T5699 |
punct |
),AF202994 |
R3528 |
T5704 |
T5699 |
punct |
", ",AF202994 |
R3529 |
T5705 |
T5699 |
conj |
AF216961,AF202994 |
R353 |
T663 |
T661 |
pobj |
species,within |
R3530 |
T5706 |
T5705 |
punct |
(,AF216961 |
R3531 |
T5707 |
T5705 |
appos |
Acdp2,AF216961 |
R3532 |
T5708 |
T5705 |
punct |
),AF216961 |
R3533 |
T5709 |
T5705 |
punct |
", ",AF216961 |
R3534 |
T5710 |
T5705 |
conj |
AF216964,AF216961 |
R3535 |
T5711 |
T5710 |
punct |
(,AF216964 |
R3536 |
T5712 |
T5710 |
appos |
Acdp3,AF216964 |
R3537 |
T5713 |
T5710 |
punct |
),AF216964 |
R3538 |
T5714 |
T5710 |
cc |
and,AF216964 |
R3539 |
T5715 |
T5710 |
conj |
AF216963,AF216964 |
R354 |
T664 |
T654 |
aux |
may,imply |
R3540 |
T5716 |
T5715 |
punct |
(,AF216963 |
R3541 |
T5717 |
T5715 |
appos |
Acdp4,AF216963 |
R3542 |
T5718 |
T5699 |
punct |
),AF202994 |
R3543 |
T5719 |
T5685 |
punct |
.,deposited |
R3544 |
T5731 |
T5732 |
compound |
Northern,blot |
R3545 |
T5732 |
T5733 |
compound |
blot,analyses |
R3546 |
T5734 |
T5733 |
prep |
of,analyses |
R3547 |
T5735 |
T5736 |
det |
the,family |
R3548 |
T5736 |
T5734 |
pobj |
family,of |
R3549 |
T5737 |
T5736 |
compound |
Acdp,family |
R355 |
T665 |
T666 |
amod |
functional,importance |
R3550 |
T5738 |
T5736 |
compound |
gene,family |
R3551 |
T5739 |
T5733 |
punct |
.,analyses |
R3552 |
T5741 |
T5742 |
compound |
S.,muscle |
R3553 |
T5742 |
T5743 |
nsubj |
muscle,represents |
R3554 |
T5744 |
T5745 |
amod |
skeletal,muscle |
R3555 |
T5745 |
T5743 |
dobj |
muscle,represents |
R3556 |
T5746 |
T5745 |
punct |
", ",muscle |
R3557 |
T5747 |
T5745 |
appos |
Sm,muscle |
R3558 |
T5748 |
T5743 |
punct |
.,represents |
R3559 |
T5750 |
T5751 |
nsubj |
Int.,represents |
R356 |
T666 |
T654 |
dobj |
importance,imply |
R3560 |
T5752 |
T5753 |
amod |
small,intestine |
R3561 |
T5753 |
T5751 |
dobj |
intestine,represents |
R3562 |
T5754 |
T5751 |
punct |
.,represents |
R3563 |
T5756 |
T5757 |
amod |
Multiple,Choice |
R3564 |
T5757 |
T5758 |
compound |
Choice,Blot |
R3565 |
T5758 |
T5760 |
compound |
Blot,filters |
R3566 |
T5759 |
T5758 |
compound |
Northern,Blot |
R3567 |
T5760 |
T5761 |
nsubjpass |
filters,purchased |
R3568 |
T5762 |
T5761 |
auxpass |
were,purchased |
R3569 |
T5763 |
T5761 |
prep |
from,purchased |
R357 |
T667 |
T666 |
acl |
associated,importance |
R3570 |
T5764 |
T5763 |
pobj |
Origene,from |
R3571 |
T5765 |
T5761 |
punct |
.,purchased |
R3572 |
T5826 |
T5827 |
compound |
Amino,acid |
R3573 |
T5827 |
T5828 |
compound |
acid,sequence |
R3574 |
T5828 |
T5829 |
compound |
sequence,alignment |
R3575 |
T5830 |
T5829 |
compound |
homology,alignment |
R3576 |
T5831 |
T5829 |
prep |
for,alignment |
R3577 |
T5832 |
T5831 |
pobj |
all,for |
R3578 |
T5833 |
T5832 |
prep |
of,all |
R3579 |
T5834 |
T5835 |
det |
the,genes |
R358 |
T668 |
T667 |
prep |
with,associated |
R3580 |
T5835 |
T5833 |
pobj |
genes,of |
R3581 |
T5836 |
T5835 |
nmod |
ACDP,genes |
R3582 |
T5837 |
T5836 |
cc |
and,ACDP |
R3583 |
T5838 |
T5836 |
conj |
Acdp,ACDP |
R3584 |
T5839 |
T5835 |
prep |
within,genes |
R3585 |
T5840 |
T5841 |
det |
the,domain |
R3586 |
T5841 |
T5839 |
pobj |
domain,within |
R3587 |
T5842 |
T5841 |
compound |
ACD,domain |
R3588 |
T5843 |
T5829 |
punct |
.,alignment |
R3589 |
T5845 |
T5846 |
det |
The,data |
R359 |
T669 |
T670 |
det |
the,genes |
R3590 |
T5846 |
T5848 |
nsubjpass |
data,deposited |
R3591 |
T5847 |
T5846 |
compound |
sequence,data |
R3592 |
T5849 |
T5846 |
prep |
for,data |
R3593 |
T5850 |
T5851 |
det |
the,genes |
R3594 |
T5851 |
T5849 |
pobj |
genes,for |
R3595 |
T5852 |
T5851 |
compound |
Acdp,genes |
R3596 |
T5853 |
T5848 |
aux |
have,deposited |
R3597 |
T5854 |
T5848 |
auxpass |
been,deposited |
R3598 |
T5855 |
T5848 |
prep |
in,deposited |
R3599 |
T5856 |
T5855 |
pobj |
GenBank,in |
R36 |
T259 |
T257 |
prep |
of,study |
R360 |
T670 |
T668 |
pobj |
genes,with |
R3600 |
T5857 |
T5848 |
prep |
under,deposited |
R3601 |
T5858 |
T5859 |
compound |
accession,AF202994 |
R3602 |
T5859 |
T5857 |
pobj |
AF202994,under |
R3603 |
T5860 |
T5859 |
compound |
number,AF202994 |
R3604 |
T5861 |
T5859 |
punct |
(,AF202994 |
R3605 |
T5862 |
T5859 |
appos |
Acdp1,AF202994 |
R3606 |
T5863 |
T5859 |
punct |
),AF202994 |
R3607 |
T5864 |
T5859 |
punct |
", ",AF202994 |
R3608 |
T5865 |
T5859 |
conj |
AF216961,AF202994 |
R3609 |
T5866 |
T5865 |
punct |
(,AF216961 |
R361 |
T671 |
T654 |
punct |
.,imply |
R3610 |
T5867 |
T5865 |
appos |
Acdp2,AF216961 |
R3611 |
T5868 |
T5865 |
punct |
),AF216961 |
R3612 |
T5869 |
T5865 |
punct |
", ",AF216961 |
R3613 |
T5870 |
T5865 |
conj |
AF216964,AF216961 |
R3614 |
T5871 |
T5870 |
punct |
(,AF216964 |
R3615 |
T5872 |
T5870 |
appos |
Acdp3,AF216964 |
R3616 |
T5873 |
T5870 |
punct |
),AF216964 |
R3617 |
T5874 |
T5870 |
cc |
and,AF216964 |
R3618 |
T5875 |
T5870 |
conj |
AF216963,AF216964 |
R3619 |
T5876 |
T5875 |
punct |
(,AF216963 |
R362 |
T673 |
T674 |
aux |
To,facilitate |
R3620 |
T5877 |
T5875 |
appos |
Acdp4,AF216963 |
R3621 |
T5878 |
T5859 |
punct |
),AF202994 |
R3622 |
T5879 |
T5848 |
punct |
.,deposited |
R3623 |
T5881 |
T5882 |
amod |
Identical,acids |
R3624 |
T5882 |
T5884 |
nsubjpass |
acids,shaded |
R3625 |
T5883 |
T5882 |
compound |
amino,acids |
R3626 |
T5885 |
T5882 |
cc |
or,acids |
R3627 |
T5886 |
T5887 |
compound |
amino,acids |
R3628 |
T5887 |
T5882 |
conj |
acids,acids |
R3629 |
T5888 |
T5887 |
prep |
with,acids |
R363 |
T674 |
T675 |
advcl |
facilitate,cloned |
R3630 |
T5889 |
T5890 |
advmod |
very,strong |
R3631 |
T5890 |
T5891 |
amod |
strong,homologies |
R3632 |
T5891 |
T5888 |
pobj |
homologies,with |
R3633 |
T5892 |
T5891 |
prep |
among,homologies |
R3634 |
T5893 |
T5894 |
det |
all,proteins |
R3635 |
T5894 |
T5892 |
pobj |
proteins,among |
R3636 |
T5895 |
T5884 |
auxpass |
were,shaded |
R3637 |
T5896 |
T5884 |
oprd |
black,shaded |
R3638 |
T5897 |
T5884 |
punct |
.,shaded |
R3639 |
T5899 |
T5900 |
amod |
Identical,acids |
R364 |
T676 |
T677 |
det |
the,analysis |
R3640 |
T5900 |
T5902 |
nsubjpass |
acids,shaded |
R3641 |
T5901 |
T5900 |
compound |
amino,acids |
R3642 |
T5903 |
T5900 |
cc |
or,acids |
R3643 |
T5904 |
T5905 |
compound |
amino,acids |
R3644 |
T5905 |
T5900 |
conj |
acids,acids |
R3645 |
T5906 |
T5905 |
prep |
with,acids |
R3646 |
T5907 |
T5908 |
advmod |
very,strong |
R3647 |
T5908 |
T5909 |
amod |
strong,homologies |
R3648 |
T5909 |
T5906 |
pobj |
homologies,with |
R3649 |
T5910 |
T5909 |
prep |
in,homologies |
R365 |
T677 |
T674 |
dobj |
analysis,facilitate |
R3650 |
T5911 |
T5910 |
pobj |
most,in |
R3651 |
T5912 |
T5911 |
prep |
of,most |
R3652 |
T5913 |
T5914 |
det |
the,proteins |
R3653 |
T5914 |
T5912 |
pobj |
proteins,of |
R3654 |
T5915 |
T5902 |
auxpass |
were,shaded |
R3655 |
T5916 |
T5902 |
oprd |
grey,shaded |
R3656 |
T5917 |
T5902 |
punct |
.,shaded |
R3657 |
T5919 |
T5920 |
compound |
Dot,lines |
R3658 |
T5920 |
T5921 |
nsubj |
lines,represent |
R3659 |
T5922 |
T5921 |
dobj |
gaps,represent |
R366 |
T678 |
T677 |
amod |
functional,analysis |
R3660 |
T5923 |
T5922 |
prep |
for,gaps |
R3661 |
T5924 |
T5925 |
det |
the,alignment |
R3662 |
T5925 |
T5923 |
pobj |
alignment,for |
R3663 |
T5926 |
T5921 |
punct |
.,represent |
R3664 |
T6010 |
T6011 |
compound |
Amino,acid |
R3665 |
T6011 |
T6012 |
compound |
acid,alignment |
R3666 |
T6013 |
T6012 |
compound |
sequence,alignment |
R3667 |
T6014 |
T6012 |
acl |
showing,alignment |
R3668 |
T6015 |
T6016 |
det |
the,conservation |
R3669 |
T6016 |
T6014 |
dobj |
conservation,showing |
R367 |
T679 |
T677 |
prep |
of,analysis |
R3670 |
T6017 |
T6016 |
prep |
of,conservation |
R3671 |
T6018 |
T6019 |
compound |
ACD,domain |
R3672 |
T6019 |
T6017 |
pobj |
domain,of |
R3673 |
T6020 |
T6014 |
prep |
in,showing |
R3674 |
T6021 |
T6022 |
amod |
various,species |
R3675 |
T6022 |
T6020 |
pobj |
species,in |
R3676 |
T6023 |
T6012 |
punct |
.,alignment |
R3677 |
T6025 |
T6026 |
nsubj |
Amip3,is |
R3678 |
T6027 |
T6028 |
det |
a,protein |
R3679 |
T6028 |
T6026 |
attr |
protein,is |
R368 |
T680 |
T681 |
det |
the,family |
R3680 |
T6029 |
T6028 |
prep |
from,protein |
R3681 |
T6030 |
T6031 |
compound |
Saccharomyces,cerevisiae |
R3682 |
T6031 |
T6029 |
pobj |
cerevisiae,from |
R3683 |
T6032 |
T6028 |
punct |
(,protein |
R3684 |
T6033 |
T6028 |
appos |
NP_014581,protein |
R3685 |
T6034 |
T6026 |
punct |
),is |
R3686 |
T6035 |
T6026 |
punct |
.,is |
R3687 |
T6037 |
T6038 |
nsubj |
CanG,is |
R3688 |
T6039 |
T6040 |
det |
a,protein |
R3689 |
T6040 |
T6038 |
attr |
protein,is |
R369 |
T681 |
T679 |
pobj |
family,of |
R3690 |
T6041 |
T6040 |
prep |
from,protein |
R3691 |
T6042 |
T6043 |
compound |
Candida,glabrata |
R3692 |
T6043 |
T6041 |
pobj |
glabrata,from |
R3693 |
T6044 |
T6040 |
punct |
(,protein |
R3694 |
T6045 |
T6040 |
appos |
AAF33142,protein |
R3695 |
T6046 |
T6038 |
punct |
),is |
R3696 |
T6047 |
T6038 |
punct |
.,is |
R3697 |
T6049 |
T6050 |
nsubj |
NeuC,is |
R3698 |
T6051 |
T6049 |
punct |
(,NeuC |
R3699 |
T6052 |
T6049 |
appos |
EAA31204,NeuC |
R37 |
T260 |
T261 |
det |
this,family |
R370 |
T682 |
T681 |
compound |
ACDP,family |
R3700 |
T6053 |
T6050 |
punct |
),is |
R3701 |
T6054 |
T6055 |
det |
a,protein |
R3702 |
T6055 |
T6050 |
attr |
protein,is |
R3703 |
T6056 |
T6055 |
amod |
hypothetical,protein |
R3704 |
T6057 |
T6055 |
prep |
from,protein |
R3705 |
T6058 |
T6059 |
compound |
Neurospora,crassa |
R3706 |
T6059 |
T6057 |
pobj |
crassa,from |
R3707 |
T6060 |
T6050 |
punct |
.,is |
R3708 |
T6062 |
T6063 |
nsubj |
DroM,is |
R3709 |
T6064 |
T6065 |
det |
a,product |
R371 |
T683 |
T681 |
compound |
gene,family |
R3710 |
T6065 |
T6063 |
attr |
product,is |
R3711 |
T6066 |
T6065 |
compound |
gene,product |
R3712 |
T6067 |
T6065 |
prep |
from,product |
R3713 |
T6068 |
T6069 |
compound |
D.,melanogaster |
R3714 |
T6069 |
T6067 |
pobj |
melanogaster,from |
R3715 |
T6070 |
T6063 |
punct |
.,is |
R3716 |
T6072 |
T6073 |
det |
The,number |
R3717 |
T6073 |
T6075 |
nsubj |
number,is |
R3718 |
T6074 |
T6073 |
compound |
accession,number |
R3719 |
T6076 |
T6073 |
prep |
for,number |
R372 |
T684 |
T675 |
punct |
", ",cloned |
R3720 |
T6077 |
T6078 |
det |
this,gene |
R3721 |
T6078 |
T6076 |
pobj |
gene,for |
R3722 |
T6079 |
T6075 |
attr |
CG40084,is |
R3723 |
T6080 |
T6075 |
prep |
in,is |
R3724 |
T6081 |
T6080 |
pobj |
BDGP,in |
R3725 |
T6082 |
T6081 |
punct |
(,BDGP |
R3726 |
T6083 |
T6084 |
compound |
Berkeley,Project |
R3727 |
T6084 |
T6081 |
appos |
Project,BDGP |
R3728 |
T6085 |
T6084 |
compound |
Drosophila,Project |
R3729 |
T6086 |
T6084 |
compound |
Genome,Project |
R373 |
T685 |
T675 |
nsubj |
we,cloned |
R3730 |
T6087 |
T6075 |
punct |
),is |
R3731 |
T6088 |
T6075 |
punct |
.,is |
R3732 |
T6090 |
T6091 |
nsubj |
AnoG,represents |
R3733 |
T6092 |
T6093 |
det |
a,protein |
R3734 |
T6093 |
T6091 |
dobj |
protein,represents |
R3735 |
T6094 |
T6093 |
prep |
from,protein |
R3736 |
T6095 |
T6096 |
det |
the,str. |
R3737 |
T6096 |
T6094 |
pobj |
str.,from |
R3738 |
T6097 |
T6096 |
compound |
anopheles,str. |
R3739 |
T6098 |
T6096 |
compound |
gambiae,str. |
R374 |
T686 |
T675 |
cc |
and,cloned |
R3740 |
T6099 |
T6100 |
punct |
(,EAA01004 |
R3741 |
T6100 |
T6094 |
parataxis |
EAA01004,from |
R3742 |
T6101 |
T6100 |
punct |
),EAA01004 |
R3743 |
T6102 |
T6091 |
punct |
.,represents |
R3744 |
T6104 |
T6105 |
nsubj |
CaeE,is |
R3745 |
T6106 |
T6104 |
punct |
(,CaeE |
R3746 |
T6107 |
T6104 |
appos |
AAK77203,CaeE |
R3747 |
T6108 |
T6105 |
punct |
),is |
R3748 |
T6109 |
T6110 |
det |
a,protein |
R3749 |
T6110 |
T6105 |
attr |
protein,is |
R375 |
T687 |
T675 |
conj |
characterized,cloned |
R3750 |
T6111 |
T6110 |
amod |
hypothetical,protein |
R3751 |
T6112 |
T6110 |
prep |
from,protein |
R3752 |
T6113 |
T6114 |
det |
the,elegans |
R3753 |
T6114 |
T6112 |
pobj |
elegans,from |
R3754 |
T6115 |
T6114 |
compound |
Caenohabditis,elegans |
R3755 |
T6116 |
T6105 |
punct |
.,is |
R3756 |
T6118 |
T6119 |
nsubj |
CorC,represents |
R3757 |
T6120 |
T6121 |
compound |
bacteria,magnesium |
R3758 |
T6121 |
T6119 |
dobj |
magnesium,represents |
R3759 |
T6122 |
T6121 |
cc |
and,magnesium |
R376 |
T688 |
T687 |
dobj |
Acdp,characterized |
R3760 |
T6123 |
T6124 |
compound |
cobalt,protein |
R3761 |
T6124 |
T6121 |
conj |
protein,magnesium |
R3762 |
T6125 |
T6124 |
compound |
efflux,protein |
R3763 |
T6126 |
T6121 |
prep |
from,magnesium |
R3764 |
T6127 |
T6128 |
det |
the,oneidensis |
R3765 |
T6128 |
T6126 |
pobj |
oneidensis,from |
R3766 |
T6129 |
T6128 |
compound |
Shewanella,oneidensis |
R3767 |
T6130 |
T6119 |
punct |
.,represents |
R3768 |
T6132 |
T6133 |
nsubj |
XyFD,is |
R3769 |
T6134 |
T6135 |
det |
a,protein |
R377 |
T689 |
T688 |
punct |
", ",Acdp |
R3770 |
T6135 |
T6133 |
attr |
protein,is |
R3771 |
T6136 |
T6135 |
amod |
hypothetical,protein |
R3772 |
T6137 |
T6135 |
prep |
from,protein |
R3773 |
T6138 |
T6139 |
det |
the,Dixon |
R3774 |
T6139 |
T6137 |
pobj |
Dixon,from |
R3775 |
T6140 |
T6139 |
compound |
Xylella,Dixon |
R3776 |
T6141 |
T6139 |
compound |
fastidiosa,Dixon |
R3777 |
T6142 |
T6135 |
punct |
(,protein |
R3778 |
T6143 |
T6135 |
appos |
ZP_00038107,protein |
R3779 |
T6144 |
T6133 |
punct |
),is |
R378 |
T690 |
T691 |
det |
the,homologue |
R3780 |
T6145 |
T6133 |
punct |
.,is |
R3781 |
T6153 |
T6154 |
amod |
Phylogenetic,tree |
R3782 |
T6155 |
T6154 |
acl |
showing,tree |
R3783 |
T6156 |
T6155 |
dobj |
relationships,showing |
R3784 |
T6157 |
T6156 |
prep |
among,relationships |
R3785 |
T6158 |
T6157 |
pobj |
proteins,among |
R3786 |
T6159 |
T6158 |
acl |
containing,proteins |
R3787 |
T6160 |
T6161 |
det |
the,domain |
R3788 |
T6161 |
T6159 |
dobj |
domain,containing |
R3789 |
T6162 |
T6161 |
compound |
ACD,domain |
R379 |
T691 |
T688 |
appos |
homologue,Acdp |
R3790 |
T6163 |
T6161 |
prep |
from,domain |
R3791 |
T6164 |
T6165 |
nmod |
figure,2 |
R3792 |
T6165 |
T6163 |
pobj |
2,from |
R3793 |
T6166 |
T6165 |
cc |
and,2 |
R3794 |
T6167 |
T6165 |
conj |
3,2 |
R3795 |
T6168 |
T6154 |
punct |
.,tree |
R3796 |
T6170 |
T6171 |
det |
The,tree |
R3797 |
T6171 |
T6173 |
nsubjpass |
tree,constructed |
R3798 |
T6172 |
T6171 |
amod |
phylogenetic,tree |
R3799 |
T6174 |
T6173 |
auxpass |
was,constructed |
R38 |
T261 |
T259 |
pobj |
family,of |
R380 |
T692 |
T691 |
compound |
mouse,homologue |
R3800 |
T6175 |
T6173 |
prep |
according,constructed |
R3801 |
T6176 |
T6175 |
prep |
to,according |
R3802 |
T6177 |
T6178 |
det |
the,calculation |
R3803 |
T6178 |
T6176 |
pobj |
calculation,to |
R3804 |
T6179 |
T6178 |
prep |
of,calculation |
R3805 |
T6180 |
T6181 |
det |
the,match |
R3806 |
T6181 |
T6179 |
pobj |
match,of |
R3807 |
T6182 |
T6181 |
amod |
best,match |
R3808 |
T6183 |
T6181 |
prep |
for,match |
R3809 |
T6184 |
T6185 |
det |
the,sequences |
R381 |
T693 |
T691 |
prep |
of,homologue |
R3810 |
T6185 |
T6183 |
pobj |
sequences,for |
R3811 |
T6186 |
T6185 |
amod |
selected,sequences |
R3812 |
T6187 |
T6173 |
punct |
.,constructed |
R3813 |
T6189 |
T6190 |
nsubj |
Abbreviations,are |
R3814 |
T6191 |
T6189 |
prep |
for,Abbreviations |
R3815 |
T6192 |
T6193 |
det |
each,protein |
R3816 |
T6193 |
T6191 |
pobj |
protein,for |
R3817 |
T6194 |
T6195 |
det |
the,same |
R3818 |
T6195 |
T6190 |
attr |
same,are |
R3819 |
T6196 |
T6197 |
mark |
as,presented |
R382 |
T694 |
T695 |
det |
the,family |
R3820 |
T6197 |
T6195 |
advcl |
presented,same |
R3821 |
T6198 |
T6197 |
prep |
in,presented |
R3822 |
T6199 |
T6198 |
pobj |
figure,in |
R3823 |
T6200 |
T6199 |
nummod |
3,figure |
R3824 |
T6201 |
T6190 |
punct |
.,are |
R3825 |
T6228 |
T6229 |
nummod |
Four,domains |
R3826 |
T6230 |
T6229 |
compound |
transmembrane,domains |
R3827 |
T6231 |
T6229 |
prep |
within,domains |
R3828 |
T6232 |
T6233 |
compound |
Acdp4,protein |
R3829 |
T6233 |
T6231 |
pobj |
protein,within |
R383 |
T695 |
T693 |
pobj |
family,of |
R3830 |
T6234 |
T6229 |
punct |
.,domains |
R3831 |
T6236 |
T6237 |
compound |
Transmembrane,domains |
R3832 |
T6237 |
T6238 |
nsubjpass |
domains,predicted |
R3833 |
T6239 |
T6238 |
auxpass |
were,predicted |
R3834 |
T6240 |
T6238 |
prep |
by,predicted |
R3835 |
T6241 |
T6242 |
det |
the,program |
R3836 |
T6242 |
T6240 |
pobj |
program,by |
R3837 |
T6243 |
T6242 |
compound |
TMHMM,program |
R3838 |
T6244 |
T6238 |
punct |
.,predicted |
R3839 |
T6246 |
T6247 |
det |
The,plot |
R384 |
T696 |
T695 |
amod |
human,family |
R3840 |
T6247 |
T6248 |
nsubj |
plot,shows |
R3841 |
T6249 |
T6250 |
det |
the,probabilities |
R3842 |
T6250 |
T6248 |
dobj |
probabilities,shows |
R3843 |
T6251 |
T6250 |
amod |
posterior,probabilities |
R3844 |
T6252 |
T6250 |
prep |
of,probabilities |
R3845 |
T6253 |
T6254 |
amod |
inside,TM |
R3846 |
T6254 |
T6258 |
compound |
TM,helix |
R3847 |
T6255 |
T6254 |
punct |
/,TM |
R3848 |
T6256 |
T6254 |
amod |
outside,TM |
R3849 |
T6257 |
T6254 |
punct |
/,TM |
R385 |
T697 |
T695 |
compound |
ACDP,family |
R3850 |
T6258 |
T6252 |
pobj |
helix,of |
R3851 |
T6259 |
T6248 |
punct |
.,shows |
R3852 |
T6261 |
T6262 |
prep |
At,shown |
R3853 |
T6263 |
T6264 |
det |
the,top |
R3854 |
T6264 |
T6261 |
pobj |
top,At |
R3855 |
T6265 |
T6264 |
prep |
of,top |
R3856 |
T6266 |
T6267 |
det |
the,plot |
R3857 |
T6267 |
T6265 |
pobj |
plot,of |
R3858 |
T6268 |
T6261 |
punct |
(,At |
R3859 |
T6269 |
T6261 |
prep |
between,At |
R386 |
T698 |
T695 |
compound |
gene,family |
R3860 |
T6270 |
T6269 |
pobj |
1,between |
R3861 |
T6271 |
T6270 |
cc |
and,1 |
R3862 |
T6272 |
T6270 |
conj |
1.2,1 |
R3863 |
T6273 |
T6262 |
punct |
),shown |
R3864 |
T6274 |
T6275 |
det |
the,prediction |
R3865 |
T6275 |
T6262 |
nsubjpass |
prediction,shown |
R3866 |
T6276 |
T6277 |
npadvmod |
N,best |
R3867 |
T6277 |
T6275 |
amod |
best,prediction |
R3868 |
T6278 |
T6277 |
punct |
-,best |
R3869 |
T6279 |
T6262 |
auxpass |
is,shown |
R387 |
T699 |
T675 |
punct |
.,cloned |
R3870 |
T6280 |
T6262 |
punct |
.,shown |
R3871 |
T6282 |
T6283 |
det |
The,plot |
R3872 |
T6283 |
T6284 |
nsubjpass |
plot,obtained |
R3873 |
T6285 |
T6284 |
auxpass |
is,obtained |
R3874 |
T6286 |
T6284 |
prep |
by,obtained |
R3875 |
T6287 |
T6286 |
pcomp |
calculating,by |
R3876 |
T6288 |
T6289 |
det |
the,probability |
R3877 |
T6289 |
T6287 |
dobj |
probability,calculating |
R3878 |
T6290 |
T6289 |
amod |
total,probability |
R3879 |
T6291 |
T6292 |
mark |
that,sits |
R388 |
T863 |
T864 |
amod |
Molecular,cloning |
R3880 |
T6292 |
T6289 |
acl |
sits,probability |
R3881 |
T6293 |
T6294 |
det |
a,residue |
R3882 |
T6294 |
T6292 |
nsubj |
residue,sits |
R3883 |
T6295 |
T6292 |
prep |
in,sits |
R3884 |
T6296 |
T6295 |
pobj |
helix,in |
R3885 |
T6297 |
T6292 |
punct |
", ",sits |
R3886 |
T6298 |
T6292 |
advmod |
inside,sits |
R3887 |
T6299 |
T6298 |
punct |
", ",inside |
R3888 |
T6300 |
T6298 |
cc |
or,inside |
R3889 |
T6301 |
T6298 |
conj |
outside,inside |
R389 |
T865 |
T864 |
prep |
of,cloning |
R3890 |
T6302 |
T6289 |
acl |
summed,probability |
R3891 |
T6303 |
T6302 |
prep |
over,summed |
R3892 |
T6304 |
T6305 |
det |
all,paths |
R3893 |
T6305 |
T6303 |
pobj |
paths,over |
R3894 |
T6306 |
T6305 |
amod |
possible,paths |
R3895 |
T6307 |
T6305 |
prep |
through,paths |
R3896 |
T6308 |
T6309 |
det |
the,model |
R3897 |
T6309 |
T6307 |
pobj |
model,through |
R3898 |
T6310 |
T6284 |
punct |
.,obtained |
R3899 |
T6368 |
T6369 |
dep |
Fig.,analysis |
R39 |
T262 |
T261 |
amod |
novel,family |
R390 |
T866 |
T867 |
det |
the,family |
R3900 |
T6370 |
T6368 |
nummod |
6A,Fig. |
R3901 |
T6371 |
T6369 |
punct |
: ,analysis |
R3902 |
T6372 |
T6369 |
compound |
Immunoblot,analysis |
R3903 |
T6373 |
T6369 |
prep |
of,analysis |
R3904 |
T6374 |
T6375 |
compound |
Acdp,proteins |
R3905 |
T6375 |
T6373 |
pobj |
proteins,of |
R3906 |
T6376 |
T6375 |
prep |
in,proteins |
R3907 |
T6377 |
T6378 |
compound |
brain,tissue |
R3908 |
T6378 |
T6379 |
compound |
tissue,extracts |
R3909 |
T6379 |
T6376 |
pobj |
extracts,in |
R391 |
T867 |
T865 |
pobj |
family,of |
R3910 |
T6380 |
T6369 |
punct |
.,analysis |
R3911 |
T6382 |
T6383 |
nsubjpass |
Immunoblotting,carried |
R3912 |
T6384 |
T6383 |
auxpass |
were,carried |
R3913 |
T6385 |
T6383 |
prt |
out,carried |
R3914 |
T6386 |
T6383 |
advcl |
using,carried |
R3915 |
T6387 |
T6388 |
det |
a,system |
R3916 |
T6388 |
T6386 |
dobj |
system,using |
R3917 |
T6389 |
T6390 |
compound |
Western,blotting |
R3918 |
T6390 |
T6388 |
compound |
blotting,system |
R3919 |
T6391 |
T6388 |
compound |
detection,system |
R392 |
T868 |
T867 |
compound |
Acdp,family |
R3920 |
T6392 |
T6393 |
punct |
(,ECL |
R3921 |
T6393 |
T6386 |
parataxis |
ECL,using |
R3922 |
T6394 |
T6393 |
punct |
),ECL |
R3923 |
T6395 |
T6396 |
punct |
(,PIERCE |
R3924 |
T6396 |
T6386 |
parataxis |
PIERCE,using |
R3925 |
T6397 |
T6396 |
punct |
),PIERCE |
R3926 |
T6398 |
T6383 |
punct |
.,carried |
R3927 |
T6400 |
T6401 |
nsubj |
Lane,probed |
R3928 |
T6402 |
T6400 |
nummod |
1,Lane |
R3929 |
T6403 |
T6401 |
punct |
", ",probed |
R393 |
T869 |
T867 |
compound |
gene,family |
R3930 |
T6404 |
T6401 |
prep |
with,probed |
R3931 |
T6405 |
T6404 |
pobj |
antibody,with |
R3932 |
T6406 |
T6405 |
acl |
generated,antibody |
R3933 |
T6407 |
T6406 |
agent |
by,generated |
R3934 |
T6408 |
T6409 |
amod |
conserved,peptide |
R3935 |
T6409 |
T6407 |
pobj |
peptide,by |
R3936 |
T6410 |
T6401 |
punct |
.,probed |
R3937 |
T6412 |
T6413 |
prep |
From,band |
R3938 |
T6414 |
T6412 |
pobj |
top,From |
R3939 |
T6415 |
T6412 |
prep |
to,From |
R394 |
T871 |
T872 |
aux |
To,clone |
R3940 |
T6416 |
T6415 |
pobj |
bottom,to |
R3941 |
T6417 |
T6413 |
punct |
", ",band |
R3942 |
T6418 |
T6413 |
det |
each,band |
R3943 |
T6419 |
T6413 |
acl |
corresponding,band |
R3944 |
T6420 |
T6419 |
prep |
to,corresponding |
R3945 |
T6421 |
T6420 |
pobj |
Acdp1,to |
R3946 |
T6422 |
T6423 |
punct |
(,kD |
R3947 |
T6423 |
T6421 |
parataxis |
kD,Acdp1 |
R3948 |
T6424 |
T6423 |
nummod |
115,kD |
R3949 |
T6425 |
T6423 |
punct |
),kD |
R395 |
T872 |
T873 |
advcl |
clone,used |
R3950 |
T6426 |
T6421 |
punct |
", ",Acdp1 |
R3951 |
T6427 |
T6421 |
conj |
Acdp2,Acdp1 |
R3952 |
T6428 |
T6429 |
punct |
(,kD |
R3953 |
T6429 |
T6427 |
parataxis |
kD,Acdp2 |
R3954 |
T6430 |
T6429 |
nummod |
100,kD |
R3955 |
T6431 |
T6429 |
punct |
),kD |
R3956 |
T6432 |
T6427 |
punct |
", ",Acdp2 |
R3957 |
T6433 |
T6427 |
conj |
Acdp4,Acdp2 |
R3958 |
T6434 |
T6435 |
punct |
(,kD |
R3959 |
T6435 |
T6433 |
parataxis |
kD,Acdp4 |
R396 |
T874 |
T875 |
det |
the,genes |
R3960 |
T6436 |
T6435 |
nummod |
90,kD |
R3961 |
T6437 |
T6435 |
punct |
),kD |
R3962 |
T6438 |
T6433 |
cc |
and,Acdp4 |
R3963 |
T6439 |
T6433 |
conj |
Acdp3,Acdp4 |
R3964 |
T6440 |
T6441 |
punct |
(,kD |
R3965 |
T6441 |
T6439 |
parataxis |
kD,Acdp3 |
R3966 |
T6442 |
T6441 |
nummod |
80,kD |
R3967 |
T6443 |
T6441 |
punct |
),kD |
R3968 |
T6444 |
T6413 |
punct |
.,band |
R3969 |
T6446 |
T6447 |
nmod |
Lane,2 |
R397 |
T875 |
T872 |
dobj |
genes,clone |
R3970 |
T6447 |
T6448 |
nsubj |
2,probed |
R3971 |
T6449 |
T6447 |
cc |
and,2 |
R3972 |
T6450 |
T6447 |
conj |
3,2 |
R3973 |
T6451 |
T6448 |
punct |
", ",probed |
R3974 |
T6452 |
T6448 |
prep |
with,probed |
R3975 |
T6453 |
T6454 |
det |
the,antibodies |
R3976 |
T6454 |
T6452 |
pobj |
antibodies,with |
R3977 |
T6455 |
T6454 |
compound |
Acdp1,antibodies |
R3978 |
T6456 |
T6454 |
acl |
generated,antibodies |
R3979 |
T6457 |
T6456 |
agent |
by,generated |
R398 |
T876 |
T875 |
compound |
mouse,genes |
R3980 |
T6458 |
T6459 |
npadvmod |
N,terminal |
R3981 |
T6459 |
T6461 |
amod |
terminal,peptides |
R3982 |
T6460 |
T6459 |
punct |
-,terminal |
R3983 |
T6461 |
T6457 |
pobj |
peptides,by |
R3984 |
T6462 |
T6459 |
cc |
and,terminal |
R3985 |
T6463 |
T6464 |
npadvmod |
C,terminal |
R3986 |
T6464 |
T6459 |
conj |
terminal,terminal |
R3987 |
T6465 |
T6464 |
punct |
-,terminal |
R3988 |
T6466 |
T6456 |
punct |
", ",generated |
R3989 |
T6467 |
T6456 |
advmod |
respectively,generated |
R399 |
T877 |
T875 |
compound |
Acdp,genes |
R3990 |
T6468 |
T6448 |
punct |
.,probed |
R3991 |
T6470 |
T6471 |
dep |
Fig.,analysis |
R3992 |
T6472 |
T6470 |
nummod |
6B,Fig. |
R3993 |
T6473 |
T6471 |
punct |
: ,analysis |
R3994 |
T6474 |
T6471 |
compound |
Immunoblot,analysis |
R3995 |
T6475 |
T6471 |
prep |
of,analysis |
R3996 |
T6476 |
T6475 |
pobj |
Acdp1,of |
R3997 |
T6477 |
T6471 |
prep |
in,analysis |
R3998 |
T6478 |
T6479 |
nmod |
HEK293,cells |
R3999 |
T6479 |
T6477 |
pobj |
cells,in |
R4 |
T220 |
T217 |
conj |
characterization,cloning |
R40 |
T263 |
T261 |
compound |
gene,family |
R400 |
T878 |
T873 |
punct |
", ",used |
R4000 |
T6480 |
T6478 |
punct |
", ",HEK293 |
R4001 |
T6481 |
T6478 |
conj |
3T3,HEK293 |
R4002 |
T6482 |
T6481 |
cc |
and,3T3 |
R4003 |
T6483 |
T6481 |
conj |
PC12,3T3 |
R4004 |
T6484 |
T6471 |
punct |
.,analysis |
R4005 |
T6486 |
T6487 |
det |
The,blots |
R4006 |
T6487 |
T6488 |
nsubjpass |
blots,probed |
R4007 |
T6489 |
T6488 |
auxpass |
were,probed |
R4008 |
T6490 |
T6488 |
prep |
with,probed |
R4009 |
T6491 |
T6492 |
det |
the,antibody |
R401 |
T879 |
T880 |
det |
the,cDNA |
R4010 |
T6492 |
T6490 |
pobj |
antibody,with |
R4011 |
T6493 |
T6492 |
prep |
against,antibody |
R4012 |
T6494 |
T6495 |
det |
the,terminus |
R4013 |
T6495 |
T6493 |
pobj |
terminus,against |
R4014 |
T6496 |
T6495 |
compound |
C,terminus |
R4015 |
T6497 |
T6495 |
punct |
-,terminus |
R4016 |
T6498 |
T6495 |
prep |
of,terminus |
R4017 |
T6499 |
T6498 |
pobj |
Acdp,of |
R4018 |
T6500 |
T6499 |
punct |
-,Acdp |
R4019 |
T6501 |
T6499 |
nummod |
1,Acdp |
R402 |
T880 |
T873 |
nsubjpass |
cDNA,used |
R4020 |
T6502 |
T6488 |
punct |
.,probed |
R4021 |
T6504 |
T6505 |
dep |
Lane,μg |
R4022 |
T6506 |
T6504 |
nummod |
1,Lane |
R4023 |
T6507 |
T6505 |
punct |
", ",μg |
R4024 |
T6508 |
T6505 |
nummod |
10,μg |
R4025 |
T6509 |
T6505 |
prep |
of,μg |
R4026 |
T6510 |
T6511 |
compound |
HEK293,lysates |
R4027 |
T6511 |
T6509 |
pobj |
lysates,of |
R4028 |
T6512 |
T6511 |
compound |
cell,lysates |
R4029 |
T6513 |
T6505 |
punct |
.,μg |
R403 |
T881 |
T880 |
amod |
human,cDNA |
R4030 |
T6515 |
T6516 |
nmod |
Lane,2 |
R4031 |
T6516 |
T6517 |
dep |
2,μg |
R4032 |
T6518 |
T6516 |
cc |
and,2 |
R4033 |
T6519 |
T6516 |
conj |
3,2 |
R4034 |
T6520 |
T6517 |
punct |
", ",μg |
R4035 |
T6521 |
T6517 |
nummod |
100,μg |
R4036 |
T6522 |
T6517 |
prep |
of,μg |
R4037 |
T6523 |
T6524 |
nmod |
3T3,lysates |
R4038 |
T6524 |
T6522 |
pobj |
lysates,of |
R4039 |
T6525 |
T6523 |
cc |
and,3T3 |
R404 |
T882 |
T880 |
compound |
ACDP,cDNA |
R4040 |
T6526 |
T6523 |
conj |
PC12,3T3 |
R4041 |
T6527 |
T6524 |
compound |
cell,lysates |
R4042 |
T6528 |
T6517 |
punct |
.,μg |
R4043 |
T6553 |
T6554 |
amod |
Subcellular,localization |
R4044 |
T6555 |
T6554 |
prep |
of,localization |
R4045 |
T6556 |
T6555 |
pobj |
Acdp1,of |
R4046 |
T6557 |
T6554 |
prep |
in,localization |
R4047 |
T6558 |
T6559 |
compound |
hippocampus,neurons |
R4048 |
T6559 |
T6557 |
pobj |
neurons,in |
R4049 |
T6560 |
T6554 |
punct |
.,localization |
R405 |
T883 |
T880 |
cc |
and,cDNA |
R4050 |
T6562 |
T6563 |
det |
A,series |
R4051 |
T6564 |
T6563 |
prep |
of,series |
R4052 |
T6565 |
T6566 |
amod |
confocal,images |
R4053 |
T6566 |
T6564 |
pobj |
images,of |
R4054 |
T6567 |
T6563 |
prep |
from,series |
R4055 |
T6568 |
T6569 |
det |
a,neuron |
R4056 |
T6569 |
T6567 |
pobj |
neuron,from |
R4057 |
T6570 |
T6569 |
amod |
cultured,neuron |
R4058 |
T6571 |
T6569 |
acl |
stained,neuron |
R4059 |
T6572 |
T6571 |
prep |
with,stained |
R406 |
T884 |
T885 |
amod |
predicted,sequences |
R4060 |
T6573 |
T6574 |
det |
an,antibody |
R4061 |
T6574 |
T6572 |
pobj |
antibody,with |
R4062 |
T6575 |
T6574 |
amod |
anti-Acdp1,antibody |
R4063 |
T6576 |
T6563 |
punct |
.,series |
R4064 |
T6578 |
T6579 |
det |
The,step |
R4065 |
T6579 |
T6580 |
nsubj |
step,is |
R4066 |
T6581 |
T6579 |
prep |
of,step |
R4067 |
T6582 |
T6583 |
det |
each,section |
R4068 |
T6583 |
T6581 |
pobj |
section,of |
R4069 |
T6584 |
T6583 |
compound |
imaging,section |
R407 |
T885 |
T880 |
conj |
sequences,cDNA |
R4070 |
T6585 |
T6586 |
nummod |
0.5,μm |
R4071 |
T6586 |
T6580 |
attr |
μm,is |
R4072 |
T6587 |
T6580 |
punct |
", ",is |
R4073 |
T6588 |
T6580 |
prep |
from,is |
R4074 |
T6589 |
T6590 |
det |
the,surface |
R4075 |
T6590 |
T6588 |
pobj |
surface,from |
R4076 |
T6591 |
T6590 |
prep |
of,surface |
R4077 |
T6592 |
T6593 |
det |
the,neuron |
R4078 |
T6593 |
T6591 |
pobj |
neuron,of |
R4079 |
T6594 |
T6595 |
punct |
(,μm |
R408 |
T886 |
T885 |
compound |
protein,sequences |
R4080 |
T6595 |
T6590 |
parataxis |
μm,surface |
R4081 |
T6596 |
T6595 |
nummod |
0,μm |
R4082 |
T6597 |
T6595 |
punct |
),μm |
R4083 |
T6598 |
T6588 |
prep |
to,from |
R4084 |
T6599 |
T6600 |
det |
the,plan |
R4085 |
T6600 |
T6598 |
pobj |
plan,to |
R4086 |
T6601 |
T6600 |
amod |
middle,plan |
R4087 |
T6602 |
T6603 |
punct |
(,μm |
R4088 |
T6603 |
T6600 |
parataxis |
μm,plan |
R4089 |
T6604 |
T6603 |
nummod |
4.5,μm |
R409 |
T887 |
T873 |
auxpass |
were,used |
R4090 |
T6605 |
T6603 |
punct |
),μm |
R4091 |
T6606 |
T6580 |
punct |
.,is |
R4092 |
T6623 |
T6624 |
nmod |
Nucleotide,homologies |
R4093 |
T6625 |
T6623 |
cc |
and,Nucleotide |
R4094 |
T6626 |
T6627 |
compound |
amino,acid |
R4095 |
T6627 |
T6623 |
conj |
acid,Nucleotide |
R4096 |
T6628 |
T6629 |
punct |
(,% |
R4097 |
T6629 |
T6624 |
parataxis |
%,homologies |
R4098 |
T6630 |
T6629 |
punct |
),% |
R4099 |
T6631 |
T6624 |
prep |
between,homologies |
R41 |
T264 |
T255 |
punct |
", ",cloned |
R410 |
T888 |
T889 |
aux |
to,search |
R4100 |
T6632 |
T6633 |
amod |
human,ACDP |
R4101 |
T6633 |
T6634 |
nmod |
ACDP,members |
R4102 |
T6634 |
T6631 |
pobj |
members,between |
R4103 |
T6635 |
T6633 |
cc |
and,ACDP |
R4104 |
T6636 |
T6637 |
compound |
mouse,Acdp |
R4105 |
T6637 |
T6633 |
conj |
Acdp,ACDP |
R4106 |
T6638 |
T6624 |
punct |
.,homologies |
R411 |
T889 |
T873 |
advcl |
search,used |
R412 |
T890 |
T891 |
det |
the,database |
R413 |
T891 |
T889 |
dobj |
database,search |
R414 |
T892 |
T891 |
compound |
mouse,database |
R415 |
T893 |
T891 |
compound |
EST,database |
R416 |
T894 |
T889 |
prep |
with,search |
R417 |
T895 |
T896 |
det |
the,programs |
R418 |
T896 |
T894 |
pobj |
programs,with |
R419 |
T897 |
T896 |
nmod |
blastn,programs |
R42 |
T265 |
T255 |
nsubj |
we,cloned |
R420 |
T898 |
T897 |
cc |
and,blastn |
R421 |
T899 |
T897 |
conj |
tblastn,blastn |
R422 |
T900 |
T873 |
punct |
.,used |
R423 |
T902 |
T903 |
compound |
Mouse,markers |
R424 |
T903 |
T905 |
nsubjpass |
markers,identified |
R425 |
T904 |
T903 |
compound |
EST,markers |
R426 |
T906 |
T903 |
acl |
corresponding,markers |
R427 |
T907 |
T906 |
prep |
to,corresponding |
R428 |
T908 |
T909 |
det |
each,member |
R429 |
T909 |
T907 |
pobj |
member,to |
R43 |
T266 |
T255 |
aux |
have,cloned |
R430 |
T910 |
T909 |
compound |
Acdp,member |
R431 |
T911 |
T905 |
auxpass |
were,identified |
R432 |
T912 |
T905 |
advmod |
then,identified |
R433 |
T913 |
T905 |
punct |
.,identified |
R434 |
T915 |
T916 |
prep |
For,corresponds |
R435 |
T917 |
T915 |
pobj |
example,For |
R436 |
T918 |
T916 |
punct |
", ",corresponds |
R437 |
T919 |
T920 |
compound |
EST,H3086H12 |
R438 |
T920 |
T916 |
nsubj |
H3086H12,corresponds |
R439 |
T921 |
T920 |
punct |
-,H3086H12 |
R44 |
T267 |
T255 |
cc |
and,cloned |
R440 |
T922 |
T920 |
nummod |
5,H3086H12 |
R441 |
T923 |
T916 |
prep |
to,corresponds |
R442 |
T924 |
T923 |
pobj |
Acdp1,to |
R443 |
T925 |
T916 |
punct |
", ",corresponds |
R444 |
T926 |
T916 |
conj |
W98010,corresponds |
R445 |
T927 |
T926 |
prep |
for,W98010 |
R446 |
T928 |
T927 |
pobj |
Acdp2,for |
R447 |
T929 |
T926 |
punct |
", ",W98010 |
R448 |
T930 |
T926 |
conj |
603299135F1,W98010 |
R449 |
T931 |
T930 |
prep |
for,603299135F1 |
R45 |
T268 |
T255 |
conj |
characterized,cloned |
R450 |
T932 |
T931 |
pobj |
Acdp3,for |
R451 |
T933 |
T930 |
cc |
and,603299135F1 |
R452 |
T934 |
T930 |
conj |
BG083791,603299135F1 |
R453 |
T935 |
T934 |
prep |
for,BG083791 |
R454 |
T936 |
T935 |
pobj |
Acdp4,for |
R455 |
T937 |
T916 |
punct |
.,corresponds |
R456 |
T939 |
T940 |
det |
A,dT |
R457 |
T940 |
T944 |
nsubjpass |
dT,used |
R458 |
T941 |
T940 |
amod |
modified,dT |
R459 |
T942 |
T940 |
compound |
oligo,dT |
R46 |
T269 |
T268 |
dobj |
Acdp,characterized |
R460 |
T943 |
T940 |
punct |
-,dT |
R461 |
T945 |
T940 |
prep |
with,dT |
R462 |
T946 |
T947 |
det |
a,tail |
R463 |
T947 |
T945 |
pobj |
tail,with |
R464 |
T948 |
T947 |
compound |
M13,tail |
R465 |
T949 |
T944 |
auxpass |
was,used |
R466 |
T950 |
T944 |
prep |
for,used |
R467 |
T951 |
T952 |
det |
the,reaction |
R468 |
T952 |
T950 |
pobj |
reaction,for |
R469 |
T953 |
T952 |
compound |
RT,reaction |
R47 |
T270 |
T269 |
punct |
", ",Acdp |
R470 |
T954 |
T944 |
punct |
.,used |
R471 |
T956 |
T957 |
det |
A,primer |
R472 |
T957 |
T959 |
nsubjpass |
primer,used |
R473 |
T958 |
T957 |
amod |
forward,primer |
R474 |
T960 |
T957 |
prep |
from,primer |
R475 |
T961 |
T962 |
det |
each,marker |
R476 |
T962 |
T960 |
pobj |
marker,from |
R477 |
T963 |
T962 |
compound |
EST,marker |
R478 |
T964 |
T962 |
cc |
and,marker |
R479 |
T965 |
T966 |
det |
the,primer |
R48 |
T271 |
T272 |
det |
the,homologue |
R480 |
T966 |
T962 |
conj |
primer,marker |
R481 |
T967 |
T966 |
compound |
M13,primer |
R482 |
T968 |
T966 |
punct |
(,primer |
R483 |
T969 |
T970 |
compound |
olig,dT |
R484 |
T970 |
T972 |
compound |
dT,tail |
R485 |
T971 |
T970 |
punct |
-,dT |
R486 |
T972 |
T966 |
appos |
tail,primer |
R487 |
T973 |
T966 |
punct |
),primer |
R488 |
T974 |
T959 |
auxpass |
were,used |
R489 |
T975 |
T976 |
aux |
to,amplify |
R49 |
T272 |
T269 |
appos |
homologue,Acdp |
R490 |
T976 |
T959 |
advcl |
amplify,used |
R491 |
T977 |
T978 |
det |
the,sequence |
R492 |
T978 |
T976 |
dobj |
sequence,amplify |
R493 |
T979 |
T980 |
nummod |
3,UTR |
R494 |
T980 |
T978 |
compound |
UTR,sequence |
R495 |
T981 |
T979 |
punct |
',3 |
R496 |
T982 |
T976 |
prep |
for,amplify |
R497 |
T983 |
T984 |
det |
each,gene |
R498 |
T984 |
T982 |
pobj |
gene,for |
R499 |
T985 |
T984 |
amod |
corresponding,gene |
R5 |
T221 |
T220 |
prep |
of,characterization |
R50 |
T273 |
T272 |
compound |
mouse,homologue |
R500 |
T986 |
T984 |
compound |
Acdp,gene |
R501 |
T987 |
T984 |
prep |
from,gene |
R502 |
T988 |
T989 |
det |
the,products |
R503 |
T989 |
T987 |
pobj |
products,from |
R504 |
T990 |
T989 |
compound |
RT,products |
R505 |
T991 |
T959 |
punct |
.,used |
R506 |
T993 |
T994 |
aux |
To,obtain |
R507 |
T994 |
T995 |
advcl |
obtain,conducted |
R508 |
T996 |
T997 |
nummod |
5,end |
R509 |
T997 |
T1000 |
nmod |
end,sequences |
R51 |
T274 |
T272 |
prep |
of,homologue |
R510 |
T998 |
T996 |
punct |
',5 |
R511 |
T999 |
T997 |
punct |
-,end |
R512 |
T1000 |
T994 |
dobj |
sequences,obtain |
R513 |
T1001 |
T1000 |
amod |
coding,sequences |
R514 |
T1002 |
T994 |
prep |
for,obtain |
R515 |
T1003 |
T1004 |
det |
the,genes |
R516 |
T1004 |
T1002 |
pobj |
genes,for |
R517 |
T1005 |
T1004 |
compound |
Acdp,genes |
R518 |
T1006 |
T995 |
punct |
", ",conducted |
R519 |
T1007 |
T995 |
nsubj |
we,conducted |
R52 |
T275 |
T276 |
det |
the,family |
R520 |
T1008 |
T1009 |
det |
a,PCR |
R521 |
T1009 |
T995 |
dobj |
PCR,conducted |
R522 |
T1010 |
T1011 |
npadvmod |
series,nested |
R523 |
T1011 |
T1009 |
amod |
nested,PCR |
R524 |
T1012 |
T995 |
prep |
with,conducted |
R525 |
T1013 |
T1012 |
pobj |
combinations,with |
R526 |
T1014 |
T1013 |
prep |
of,combinations |
R527 |
T1015 |
T1016 |
nmod |
mouse,primers |
R528 |
T1016 |
T1014 |
pobj |
primers,of |
R529 |
T1017 |
T1015 |
cc |
and,mouse |
R53 |
T276 |
T274 |
pobj |
family,of |
R530 |
T1018 |
T1015 |
conj |
human,mouse |
R531 |
T1019 |
T995 |
punct |
.,conducted |
R532 |
T1021 |
T1022 |
det |
The,sequences |
R533 |
T1022 |
T1026 |
nsubjpass |
sequences,identified |
R534 |
T1023 |
T1022 |
nummod |
5,sequences |
R535 |
T1024 |
T1023 |
punct |
',5 |
R536 |
T1025 |
T1022 |
compound |
UTR,sequences |
R537 |
T1027 |
T1026 |
auxpass |
were,identified |
R538 |
T1028 |
T1026 |
prep |
by,identified |
R539 |
T1029 |
T1030 |
advmod |
directly,sequencing |
R54 |
T277 |
T276 |
amod |
human,family |
R540 |
T1030 |
T1028 |
pcomp |
sequencing,by |
R541 |
T1031 |
T1032 |
compound |
BAC,DNA |
R542 |
T1032 |
T1030 |
dobj |
DNA,sequencing |
R543 |
T1033 |
T1032 |
acl |
containing,DNA |
R544 |
T1034 |
T1035 |
det |
the,genes |
R545 |
T1035 |
T1033 |
dobj |
genes,containing |
R546 |
T1036 |
T1035 |
amod |
corresponding,genes |
R547 |
T1037 |
T1035 |
compound |
Acdp,genes |
R548 |
T1038 |
T1026 |
punct |
.,identified |
R549 |
T1040 |
T1041 |
det |
The,clones |
R55 |
T278 |
T276 |
compound |
ACDP,family |
R550 |
T1041 |
T1043 |
nsubjpass |
clones,identified |
R551 |
T1042 |
T1041 |
compound |
BAC,clones |
R552 |
T1044 |
T1043 |
auxpass |
were,identified |
R553 |
T1045 |
T1043 |
prep |
by,identified |
R554 |
T1046 |
T1045 |
pcomp |
screening,by |
R555 |
T1047 |
T1048 |
det |
a,library |
R556 |
T1048 |
T1046 |
dobj |
library,screening |
R557 |
T1049 |
T1050 |
compound |
CITB,DNA |
R558 |
T1050 |
T1048 |
compound |
DNA,library |
R559 |
T1051 |
T1050 |
compound |
mouse,DNA |
R56 |
T279 |
T276 |
compound |
gene,family |
R560 |
T1052 |
T1050 |
compound |
BAC,DNA |
R561 |
T1053 |
T1054 |
punct |
(,Genetics |
R562 |
T1054 |
T1048 |
parataxis |
Genetics,library |
R563 |
T1055 |
T1054 |
compound |
Research,Genetics |
R564 |
T1056 |
T1054 |
punct |
),Genetics |
R565 |
T1057 |
T1043 |
punct |
.,identified |
R566 |
T1059 |
T1060 |
det |
The,sequences |
R567 |
T1060 |
T1064 |
nsubjpass |
sequences,confirmed |
R568 |
T1061 |
T1060 |
nummod |
5,sequences |
R569 |
T1062 |
T1061 |
punct |
',5 |
R57 |
T280 |
T255 |
punct |
.,cloned |
R570 |
T1063 |
T1060 |
compound |
UTR,sequences |
R571 |
T1065 |
T1060 |
acl |
obtained,sequences |
R572 |
T1066 |
T1065 |
prep |
from,obtained |
R573 |
T1067 |
T1066 |
pcomp |
above,from |
R574 |
T1068 |
T1064 |
auxpass |
were,confirmed |
R575 |
T1069 |
T1064 |
advmod |
further,confirmed |
R576 |
T1070 |
T1064 |
prep |
by,confirmed |
R577 |
T1071 |
T1072 |
compound |
RT,PCR |
R578 |
T1072 |
T1070 |
pobj |
PCR,by |
R579 |
T1073 |
T1072 |
punct |
-,PCR |
R58 |
T284 |
T285 |
det |
The,genes |
R580 |
T1074 |
T1064 |
punct |
.,confirmed |
R581 |
T1076 |
T1077 |
det |
The,gene |
R582 |
T1077 |
T1079 |
nsubj |
gene,contains |
R583 |
T1078 |
T1077 |
compound |
Acdp1,gene |
R584 |
T1080 |
T1081 |
nummod |
"3,631",bp |
R585 |
T1081 |
T1079 |
dobj |
bp,contains |
R586 |
T1082 |
T1081 |
prep |
of,bp |
R587 |
T1083 |
T1084 |
compound |
nucleotide,sequence |
R588 |
T1084 |
T1082 |
pobj |
sequence,of |
R589 |
T1085 |
T1079 |
cc |
and,contains |
R59 |
T285 |
T288 |
nsubj |
genes,contain |
R590 |
T1086 |
T1079 |
conj |
encodes,contains |
R591 |
T1087 |
T1088 |
det |
a,protein |
R592 |
T1088 |
T1086 |
dobj |
protein,encodes |
R593 |
T1089 |
T1088 |
amod |
predicted,protein |
R594 |
T1090 |
T1086 |
prep |
with,encodes |
R595 |
T1091 |
T1092 |
nummod |
951,acids |
R596 |
T1092 |
T1090 |
pobj |
acids,with |
R597 |
T1093 |
T1092 |
compound |
amino,acids |
R598 |
T1094 |
T1095 |
punct |
(,AA |
R599 |
T1095 |
T1086 |
parataxis |
AA,encodes |
R6 |
T222 |
T223 |
det |
the,family |
R60 |
T286 |
T285 |
nummod |
four,genes |
R600 |
T1096 |
T1095 |
punct |
),AA |
R601 |
T1097 |
T1079 |
punct |
.,contains |
R602 |
T1099 |
T1100 |
det |
The,genes |
R603 |
T1100 |
T1104 |
nsubj |
genes,contain |
R604 |
T1101 |
T1100 |
amod |
other,genes |
R605 |
T1102 |
T1100 |
nummod |
three,genes |
R606 |
T1103 |
T1100 |
compound |
Acdp,genes |
R607 |
T1105 |
T1100 |
punct |
(,genes |
R608 |
T1106 |
T1100 |
appos |
Acdp2,genes |
R609 |
T1107 |
T1106 |
punct |
", ",Acdp2 |
R61 |
T287 |
T285 |
compound |
Acdp,genes |
R610 |
T1108 |
T1106 |
nummod |
3,Acdp2 |
R611 |
T1109 |
T1106 |
cc |
and,Acdp2 |
R612 |
T1110 |
T1106 |
conj |
4,Acdp2 |
R613 |
T1111 |
T1100 |
punct |
),genes |
R614 |
T1112 |
T1113 |
nummod |
"3,244",bp |
R615 |
T1113 |
T1104 |
dobj |
bp,contain |
R616 |
T1114 |
T1113 |
punct |
", ",bp |
R617 |
T1115 |
T1116 |
nummod |
"2,684",bp |
R618 |
T1116 |
T1113 |
conj |
bp,bp |
R619 |
T1117 |
T1116 |
cc |
and,bp |
R62 |
T289 |
T285 |
punct |
(,genes |
R620 |
T1118 |
T1119 |
nummod |
"2,743",bp |
R621 |
T1119 |
T1116 |
conj |
bp,bp |
R622 |
T1120 |
T1113 |
prep |
of,bp |
R623 |
T1121 |
T1122 |
compound |
cDNA,sequences |
R624 |
T1122 |
T1120 |
pobj |
sequences,of |
R625 |
T1123 |
T1104 |
punct |
", ",contain |
R626 |
T1124 |
T1104 |
cc |
and,contain |
R627 |
T1125 |
T1104 |
conj |
encode,contain |
R628 |
T1126 |
T1127 |
amod |
deduced,proteins |
R629 |
T1127 |
T1125 |
dobj |
proteins,encode |
R63 |
T290 |
T285 |
appos |
Acdp1,genes |
R630 |
T1128 |
T1127 |
prep |
of,proteins |
R631 |
T1129 |
T1130 |
nummod |
874,acids |
R632 |
T1130 |
T1128 |
pobj |
acids,of |
R633 |
T1131 |
T1130 |
compound |
amino,acids |
R634 |
T1132 |
T1130 |
punct |
", ",acids |
R635 |
T1133 |
T1134 |
nummod |
713,acids |
R636 |
T1134 |
T1130 |
conj |
acids,acids |
R637 |
T1135 |
T1134 |
compound |
amino,acids |
R638 |
T1136 |
T1134 |
cc |
and,acids |
R639 |
T1137 |
T1138 |
nummod |
771,acids |
R64 |
T291 |
T290 |
punct |
", ",Acdp1 |
R640 |
T1138 |
T1134 |
conj |
acids,acids |
R641 |
T1139 |
T1138 |
compound |
amino,acids |
R642 |
T1140 |
T1125 |
punct |
", ",encode |
R643 |
T1141 |
T1125 |
advmod |
respectively,encode |
R644 |
T1142 |
T1104 |
punct |
.,contain |
R645 |
T1296 |
T1297 |
compound |
Tissue,distribution |
R646 |
T1299 |
T1300 |
compound |
Northern,blot |
R647 |
T1300 |
T1301 |
compound |
blot,analyses |
R648 |
T1301 |
T1302 |
nsubjpass |
analyses,carried |
R649 |
T1303 |
T1301 |
prep |
of,analyses |
R65 |
T292 |
T290 |
conj |
Acdp2,Acdp1 |
R650 |
T1304 |
T1305 |
det |
the,family |
R651 |
T1305 |
T1303 |
pobj |
family,of |
R652 |
T1306 |
T1305 |
compound |
Acdp,family |
R653 |
T1307 |
T1305 |
compound |
gene,family |
R654 |
T1308 |
T1302 |
auxpass |
were,carried |
R655 |
T1309 |
T1302 |
prt |
out,carried |
R656 |
T1310 |
T1302 |
advcl |
using,carried |
R657 |
T1311 |
T1310 |
dobj |
membranes,using |
R658 |
T1312 |
T1311 |
acl |
purchased,membranes |
R659 |
T1313 |
T1312 |
prep |
from,purchased |
R66 |
T293 |
T292 |
punct |
", ",Acdp2 |
R660 |
T1314 |
T1313 |
pobj |
Origene,from |
R661 |
T1315 |
T1302 |
punct |
.,carried |
R662 |
T1317 |
T1318 |
det |
A,total |
R663 |
T1318 |
T1319 |
nsubjpass |
total,included |
R664 |
T1320 |
T1318 |
prep |
of,total |
R665 |
T1321 |
T1322 |
nummod |
12,tissues |
R666 |
T1322 |
T1320 |
pobj |
tissues,of |
R667 |
T1323 |
T1322 |
compound |
mouse,tissues |
R668 |
T1324 |
T1319 |
auxpass |
were,included |
R669 |
T1325 |
T1319 |
prep |
in,included |
R67 |
T294 |
T292 |
conj |
Acdp3,Acdp2 |
R670 |
T1326 |
T1327 |
det |
the,study |
R671 |
T1327 |
T1325 |
pobj |
study,in |
R672 |
T1328 |
T1329 |
punct |
(,Fig. |
R673 |
T1329 |
T1319 |
parataxis |
Fig.,included |
R674 |
T1330 |
T1329 |
nummod |
1,Fig. |
R675 |
T1331 |
T1329 |
punct |
),Fig. |
R676 |
T1332 |
T1319 |
punct |
.,included |
R677 |
T1334 |
T1335 |
prep |
Due,were |
R678 |
T1336 |
T1334 |
pcomp |
to,Due |
R679 |
T1337 |
T1338 |
compound |
sequence,homologies |
R68 |
T295 |
T294 |
cc |
and,Acdp3 |
R680 |
T1338 |
T1334 |
pobj |
homologies,Due |
R681 |
T1339 |
T1338 |
prep |
between,homologies |
R682 |
T1340 |
T1341 |
det |
each,member |
R683 |
T1341 |
T1339 |
pobj |
member,between |
R684 |
T1342 |
T1341 |
compound |
Acdp,member |
R685 |
T1343 |
T1341 |
prep |
within,member |
R686 |
T1344 |
T1345 |
det |
the,domain |
R687 |
T1345 |
T1343 |
pobj |
domain,within |
R688 |
T1346 |
T1345 |
amod |
conserved,domain |
R689 |
T1347 |
T1335 |
punct |
", ",were |
R69 |
T296 |
T294 |
conj |
Acdp4,Acdp3 |
R690 |
T1348 |
T1335 |
nsubj |
probes,were |
R691 |
T1349 |
T1348 |
prep |
for,probes |
R692 |
T1350 |
T1351 |
compound |
Northern,bolts |
R693 |
T1351 |
T1349 |
pobj |
bolts,for |
R694 |
T1352 |
T1353 |
compound |
PCR,fragments |
R695 |
T1353 |
T1335 |
attr |
fragments,were |
R696 |
T1354 |
T1353 |
prep |
from,fragments |
R697 |
T1355 |
T1356 |
det |
the,exon |
R698 |
T1356 |
T1354 |
pobj |
exon,from |
R699 |
T1357 |
T1356 |
amod |
last,exon |
R7 |
T223 |
T221 |
pobj |
family,of |
R70 |
T297 |
T288 |
punct |
),contain |
R700 |
T1358 |
T1356 |
cc |
and,exon |
R701 |
T1359 |
T1360 |
det |
the,sequences |
R702 |
T1360 |
T1356 |
conj |
sequences,exon |
R703 |
T1361 |
T1362 |
nummod |
3,region |
R704 |
T1362 |
T1360 |
compound |
region,sequences |
R705 |
T1363 |
T1361 |
punct |
',3 |
R706 |
T1364 |
T1362 |
amod |
untranslated,region |
R707 |
T1365 |
T1335 |
punct |
.,were |
R708 |
T1367 |
T1368 |
det |
The,messages |
R709 |
T1368 |
T1371 |
nsubj |
messages,showed |
R71 |
T298 |
T299 |
nummod |
"3,631",bp |
R710 |
T1369 |
T1368 |
compound |
mouse,messages |
R711 |
T1370 |
T1368 |
compound |
Acdp,messages |
R712 |
T1372 |
T1373 |
advmod |
almost,distributions |
R713 |
T1373 |
T1371 |
dobj |
distributions,showed |
R714 |
T1374 |
T1373 |
det |
the,distributions |
R715 |
T1375 |
T1373 |
amod |
same,distributions |
R716 |
T1376 |
T1373 |
compound |
tissue,distributions |
R717 |
T1377 |
T1373 |
prep |
as,distributions |
R718 |
T1378 |
T1379 |
det |
the,genes |
R719 |
T1379 |
T1377 |
pobj |
genes,as |
R72 |
T299 |
T288 |
dobj |
bp,contain |
R720 |
T1380 |
T1379 |
amod |
human,genes |
R721 |
T1381 |
T1379 |
compound |
ACDP,genes |
R722 |
T1382 |
T1371 |
punct |
.,showed |
R723 |
T1384 |
T1385 |
compound |
Acdp1,message |
R724 |
T1385 |
T1386 |
nsubjpass |
message,expressed |
R725 |
T1387 |
T1386 |
auxpass |
is,expressed |
R726 |
T1388 |
T1386 |
advmod |
highly,expressed |
R727 |
T1389 |
T1386 |
prep |
in,expressed |
R728 |
T1390 |
T1391 |
det |
the,brain |
R729 |
T1391 |
T1389 |
pobj |
brain,in |
R73 |
T300 |
T299 |
punct |
", ",bp |
R730 |
T1392 |
T1386 |
punct |
", ",expressed |
R731 |
T1393 |
T1394 |
mark |
while,showed |
R732 |
T1394 |
T1386 |
advcl |
showed,expressed |
R733 |
T1395 |
T1394 |
nsubj |
kidney,showed |
R734 |
T1396 |
T1395 |
cc |
and,kidney |
R735 |
T1397 |
T1395 |
conj |
testis,kidney |
R736 |
T1398 |
T1394 |
advmod |
also,showed |
R737 |
T1399 |
T1400 |
amod |
low,levels |
R738 |
T1400 |
T1394 |
dobj |
levels,showed |
R739 |
T1401 |
T1400 |
prep |
of,levels |
R74 |
T301 |
T302 |
nummod |
"3,244",bp |
R740 |
T1402 |
T1401 |
pobj |
expression,of |
R741 |
T1403 |
T1386 |
punct |
.,expressed |
R742 |
T1405 |
T1406 |
nsubj |
Acdp2,showed |
R743 |
T1407 |
T1408 |
amod |
higher,expressions |
R744 |
T1408 |
T1406 |
dobj |
expressions,showed |
R745 |
T1409 |
T1406 |
prep |
in,showed |
R746 |
T1410 |
T1411 |
det |
the,brain |
R747 |
T1411 |
T1409 |
pobj |
brain,in |
R748 |
T1412 |
T1411 |
punct |
", ",brain |
R749 |
T1413 |
T1411 |
conj |
kidney,brain |
R75 |
T302 |
T299 |
conj |
bp,bp |
R750 |
T1414 |
T1413 |
cc |
and,kidney |
R751 |
T1415 |
T1413 |
conj |
liver,kidney |
R752 |
T1416 |
T1406 |
punct |
.,showed |
R753 |
T1418 |
T1419 |
advmod |
However,was |
R754 |
T1420 |
T1419 |
punct |
", ",was |
R755 |
T1421 |
T1422 |
det |
the,transcript |
R756 |
T1422 |
T1419 |
nsubj |
transcript,was |
R757 |
T1423 |
T1422 |
compound |
Acdp2,transcript |
R758 |
T1424 |
T1419 |
neg |
not,was |
R759 |
T1425 |
T1419 |
acomp |
present,was |
R76 |
T303 |
T302 |
punct |
", ",bp |
R760 |
T1426 |
T1419 |
prep |
in,was |
R761 |
T1427 |
T1428 |
det |
the,muscle |
R762 |
T1428 |
T1426 |
pobj |
muscle,in |
R763 |
T1429 |
T1428 |
compound |
skeleton,muscle |
R764 |
T1430 |
T1428 |
cc |
and,muscle |
R765 |
T1431 |
T1428 |
conj |
skin,muscle |
R766 |
T1432 |
T1419 |
punct |
", ",was |
R767 |
T1433 |
T1419 |
cc |
and,was |
R768 |
T1434 |
T1435 |
nsubj |
it,showed |
R769 |
T1435 |
T1419 |
conj |
showed,was |
R77 |
T304 |
T305 |
nummod |
"2,684",bp |
R770 |
T1436 |
T1437 |
advmod |
very,low |
R771 |
T1437 |
T1438 |
amod |
low,levels |
R772 |
T1438 |
T1435 |
dobj |
levels,showed |
R773 |
T1439 |
T1438 |
prep |
of,levels |
R774 |
T1440 |
T1439 |
pobj |
expression,of |
R775 |
T1441 |
T1435 |
prep |
in,showed |
R776 |
T1442 |
T1443 |
det |
the,rest |
R777 |
T1443 |
T1441 |
pobj |
rest,in |
R778 |
T1444 |
T1443 |
prep |
of,rest |
R779 |
T1445 |
T1444 |
pobj |
tissues,of |
R78 |
T305 |
T302 |
conj |
bp,bp |
R780 |
T1446 |
T1435 |
punct |
.,showed |
R781 |
T1448 |
T1449 |
nsubj |
Acdp3,showed |
R782 |
T1449 |
T1452 |
ccomp |
showed,observed |
R783 |
T1450 |
T1448 |
cc |
and,Acdp3 |
R784 |
T1451 |
T1448 |
conj |
Acdp4,Acdp3 |
R785 |
T1453 |
T1454 |
amod |
different,levels |
R786 |
T1454 |
T1449 |
dobj |
levels,showed |
R787 |
T1455 |
T1454 |
prep |
of,levels |
R788 |
T1456 |
T1455 |
pobj |
expression,of |
R789 |
T1457 |
T1449 |
prep |
in,showed |
R79 |
T306 |
T305 |
cc |
and,bp |
R790 |
T1458 |
T1459 |
det |
all,tissues |
R791 |
T1459 |
T1457 |
pobj |
tissues,in |
R792 |
T1460 |
T1459 |
acl |
tested,tissues |
R793 |
T1461 |
T1452 |
punct |
;,observed |
R794 |
T1462 |
T1463 |
det |
the,expressions |
R795 |
T1463 |
T1452 |
nsubjpass |
expressions,observed |
R796 |
T1464 |
T1463 |
amod |
highest,expressions |
R797 |
T1465 |
T1463 |
prep |
for,expressions |
R798 |
T1466 |
T1465 |
pobj |
Acdp3,for |
R799 |
T1467 |
T1452 |
auxpass |
were,observed |
R8 |
T224 |
T223 |
compound |
mouse,family |
R80 |
T307 |
T308 |
nummod |
"2,743",bp |
R800 |
T1468 |
T1452 |
prep |
in,observed |
R801 |
T1469 |
T1470 |
det |
the,brain |
R802 |
T1470 |
T1468 |
pobj |
brain,in |
R803 |
T1471 |
T1470 |
punct |
", ",brain |
R804 |
T1472 |
T1470 |
conj |
kidney,brain |
R805 |
T1473 |
T1472 |
punct |
", ",kidney |
R806 |
T1474 |
T1472 |
conj |
liver,kidney |
R807 |
T1475 |
T1474 |
cc |
and,liver |
R808 |
T1476 |
T1474 |
conj |
heart,liver |
R809 |
T1477 |
T1452 |
punct |
", ",observed |
R81 |
T308 |
T305 |
conj |
bp,bp |
R810 |
T1478 |
T1452 |
cc |
and,observed |
R811 |
T1479 |
T1480 |
det |
the,expressions |
R812 |
T1480 |
T1482 |
nsubjpass |
expressions,observed |
R813 |
T1481 |
T1480 |
amod |
highest,expressions |
R814 |
T1482 |
T1452 |
conj |
observed,observed |
R815 |
T1483 |
T1480 |
prep |
for,expressions |
R816 |
T1484 |
T1483 |
pobj |
Acdp4,for |
R817 |
T1485 |
T1482 |
auxpass |
were,observed |
R818 |
T1486 |
T1482 |
prep |
in,observed |
R819 |
T1487 |
T1488 |
det |
the,kidney |
R82 |
T309 |
T299 |
prep |
of,bp |
R820 |
T1488 |
T1486 |
pobj |
kidney,in |
R821 |
T1489 |
T1488 |
punct |
", ",kidney |
R822 |
T1490 |
T1491 |
amod |
small,intestine |
R823 |
T1491 |
T1488 |
conj |
intestine,kidney |
R824 |
T1492 |
T1491 |
cc |
and,intestine |
R825 |
T1493 |
T1491 |
conj |
testis,intestine |
R826 |
T1494 |
T1452 |
punct |
.,observed |
R827 |
T1496 |
T1497 |
det |
The,levels |
R828 |
T1497 |
T1499 |
nsubj |
levels,were |
R829 |
T1498 |
T1497 |
compound |
expression,levels |
R83 |
T310 |
T311 |
compound |
cDNA,sequences |
R830 |
T1499 |
T1507 |
ccomp |
were,showed |
R831 |
T1500 |
T1497 |
prep |
for,levels |
R832 |
T1501 |
T1500 |
pobj |
Acdp3,for |
R833 |
T1502 |
T1501 |
cc |
and,Acdp3 |
R834 |
T1503 |
T1501 |
conj |
4,Acdp3 |
R835 |
T1504 |
T1497 |
prep |
in,levels |
R836 |
T1505 |
T1506 |
compound |
skeleton,muscle |
R837 |
T1506 |
T1504 |
pobj |
muscle,in |
R838 |
T1508 |
T1509 |
advmod |
barely,detectable |
R839 |
T1509 |
T1499 |
acomp |
detectable,were |
R84 |
T311 |
T309 |
pobj |
sequences,of |
R840 |
T1510 |
T1507 |
punct |
;,showed |
R841 |
T1511 |
T1507 |
advmod |
however,showed |
R842 |
T1512 |
T1507 |
punct |
", ",showed |
R843 |
T1513 |
T1514 |
compound |
β,actin |
R844 |
T1514 |
T1507 |
nsubj |
actin,showed |
R845 |
T1515 |
T1514 |
punct |
-,actin |
R846 |
T1516 |
T1517 |
amod |
normal,expression |
R847 |
T1517 |
T1507 |
dobj |
expression,showed |
R848 |
T1518 |
T1507 |
advcl |
suggesting,showed |
R849 |
T1519 |
T1520 |
mark |
that,were |
R85 |
T312 |
T288 |
punct |
", ",contain |
R850 |
T1520 |
T1518 |
ccomp |
were,suggesting |
R851 |
T1521 |
T1522 |
det |
the,results |
R852 |
T1522 |
T1520 |
nsubj |
results,were |
R853 |
T1523 |
T1520 |
neg |
not,were |
R854 |
T1524 |
T1525 |
det |
a,consequence |
R855 |
T1525 |
T1520 |
attr |
consequence,were |
R856 |
T1526 |
T1525 |
prep |
of,consequence |
R857 |
T1527 |
T1528 |
amod |
bad,quality |
R858 |
T1528 |
T1526 |
pobj |
quality,of |
R859 |
T1529 |
T1528 |
compound |
RNA,quality |
R86 |
T313 |
T288 |
cc |
and,contain |
R860 |
T1530 |
T1531 |
punct |
(,shown |
R861 |
T1531 |
T1507 |
parataxis |
shown,showed |
R862 |
T1532 |
T1531 |
nsubj |
data,shown |
R863 |
T1533 |
T1531 |
neg |
not,shown |
R864 |
T1534 |
T1531 |
punct |
),shown |
R865 |
T1535 |
T1507 |
punct |
.,showed |
R866 |
T1537 |
T1538 |
det |
The,pattern |
R867 |
T1538 |
T1541 |
nsubjpass |
pattern,taken |
R868 |
T1539 |
T1538 |
amod |
ubiquitous,pattern |
R869 |
T1540 |
T1538 |
compound |
expression,pattern |
R87 |
T314 |
T288 |
conj |
encode,contain |
R870 |
T1542 |
T1541 |
aux |
may,taken |
R871 |
T1543 |
T1541 |
auxpass |
be,taken |
R872 |
T1544 |
T1541 |
prep |
as,taken |
R873 |
T1545 |
T1546 |
det |
another,indication |
R874 |
T1546 |
T1544 |
pobj |
indication,as |
R875 |
T1547 |
T1546 |
prep |
of,indication |
R876 |
T1548 |
T1549 |
det |
the,importance |
R877 |
T1549 |
T1547 |
pobj |
importance,of |
R878 |
T1550 |
T1549 |
amod |
functional,importance |
R879 |
T1551 |
T1549 |
prep |
of,importance |
R88 |
T315 |
T316 |
amod |
deduced,proteins |
R880 |
T1552 |
T1553 |
compound |
Acdp,proteins |
R881 |
T1553 |
T1551 |
pobj |
proteins,of |
R882 |
T1554 |
T1549 |
prep |
in,importance |
R883 |
T1555 |
T1556 |
amod |
fundamental,processes |
R884 |
T1556 |
T1554 |
pobj |
processes,in |
R885 |
T1557 |
T1556 |
amod |
biological,processes |
R886 |
T1558 |
T1541 |
prep |
in,taken |
R887 |
T1559 |
T1558 |
pobj |
addition,in |
R888 |
T1560 |
T1559 |
prep |
to,addition |
R889 |
T1561 |
T1562 |
det |
the,conservation |
R89 |
T316 |
T314 |
dobj |
proteins,encode |
R890 |
T1562 |
T1560 |
pobj |
conservation,to |
R891 |
T1563 |
T1562 |
compound |
sequence,conservation |
R892 |
T1564 |
T1562 |
prep |
in,conservation |
R893 |
T1565 |
T1566 |
advmod |
evolutionarily,divergent |
R894 |
T1566 |
T1567 |
amod |
divergent,species |
R895 |
T1567 |
T1564 |
pobj |
species,in |
R896 |
T1568 |
T1541 |
punct |
.,taken |
R897 |
T1609 |
T1610 |
amod |
Chromosomal,location |
R898 |
T1612 |
T1613 |
compound |
Radiation,mapping |
R899 |
T1613 |
T1615 |
nsubj |
mapping,indicated |
R9 |
T225 |
T223 |
compound |
Acdp,family |
R90 |
T317 |
T316 |
prep |
of,proteins |
R900 |
T1614 |
T1613 |
compound |
hybrid,mapping |
R901 |
T1616 |
T1617 |
mark |
that,maps |
R902 |
T1617 |
T1615 |
ccomp |
maps,indicated |
R903 |
T1618 |
T1619 |
det |
the,gene |
R904 |
T1619 |
T1617 |
nsubj |
gene,maps |
R905 |
T1620 |
T1619 |
compound |
Acdp1,gene |
R906 |
T1621 |
T1617 |
prep |
to,maps |
R907 |
T1622 |
T1621 |
pobj |
chromosome,to |
R908 |
T1623 |
T1622 |
nummod |
19,chromosome |
R909 |
T1624 |
T1617 |
prep |
between,maps |
R91 |
T318 |
T319 |
nummod |
951,acids |
R910 |
T1625 |
T1626 |
compound |
markers,D19Mit119 |
R911 |
T1626 |
T1624 |
pobj |
D19Mit119,between |
R912 |
T1627 |
T1628 |
punct |
(,cR |
R913 |
T1628 |
T1626 |
parataxis |
cR,D19Mit119 |
R914 |
T1629 |
T1628 |
nummod |
34.3,cR |
R915 |
T1630 |
T1628 |
amod |
proximal,cR |
R916 |
T1631 |
T1628 |
punct |
),cR |
R917 |
T1632 |
T1626 |
cc |
and,D19Mit119 |
R918 |
T1633 |
T1626 |
conj |
D19Mit112,D19Mit119 |
R919 |
T1634 |
T1635 |
punct |
(,cR |
R92 |
T319 |
T317 |
pobj |
acids,of |
R920 |
T1635 |
T1633 |
parataxis |
cR,D19Mit112 |
R921 |
T1636 |
T1635 |
nummod |
13.6,cR |
R922 |
T1637 |
T1635 |
amod |
distal,cR |
R923 |
T1638 |
T1635 |
punct |
),cR |
R924 |
T1639 |
T1615 |
punct |
.,indicated |
R925 |
T1641 |
T1642 |
det |
The,gene |
R926 |
T1642 |
T1644 |
nsubj |
gene,maps |
R927 |
T1643 |
T1642 |
compound |
Acdp2,gene |
R928 |
T1645 |
T1646 |
advmod |
slightly,more |
R929 |
T1646 |
T1647 |
advmod |
more,distal |
R93 |
T320 |
T318 |
punct |
", ",951 |
R930 |
T1647 |
T1644 |
advcl |
distal,maps |
R931 |
T1648 |
T1644 |
prep |
to,maps |
R932 |
T1649 |
T1650 |
det |
the,Acdp1 |
R933 |
T1650 |
T1648 |
pobj |
Acdp1,to |
R934 |
T1651 |
T1650 |
prep |
on,Acdp1 |
R935 |
T1652 |
T1651 |
pobj |
chromosome,on |
R936 |
T1653 |
T1652 |
nummod |
19,chromosome |
R937 |
T1654 |
T1644 |
prep |
between,maps |
R938 |
T1655 |
T1654 |
pobj |
D19Mit9,between |
R939 |
T1656 |
T1657 |
punct |
(,cR |
R94 |
T321 |
T318 |
conj |
874,951 |
R940 |
T1657 |
T1655 |
parataxis |
cR,D19Mit9 |
R941 |
T1658 |
T1657 |
nummod |
2.4,cR |
R942 |
T1659 |
T1657 |
amod |
proximal,cR |
R943 |
T1660 |
T1657 |
punct |
),cR |
R944 |
T1661 |
T1655 |
cc |
and,D19Mit9 |
R945 |
T1662 |
T1655 |
conj |
D19Mit38,D19Mit9 |
R946 |
T1663 |
T1664 |
punct |
(,cR |
R947 |
T1664 |
T1662 |
parataxis |
cR,D19Mit38 |
R948 |
T1665 |
T1664 |
nummod |
15.1,cR |
R949 |
T1666 |
T1664 |
amod |
distal,cR |
R95 |
T322 |
T321 |
punct |
", ",874 |
R950 |
T1667 |
T1664 |
punct |
),cR |
R951 |
T1668 |
T1644 |
punct |
.,maps |
R952 |
T1670 |
T1671 |
det |
The,genes |
R953 |
T1671 |
T1675 |
nsubj |
genes,map |
R954 |
T1672 |
T1671 |
nmod |
Acdp3,genes |
R955 |
T1673 |
T1672 |
cc |
and,Acdp3 |
R956 |
T1674 |
T1672 |
conj |
Acdp4,Acdp3 |
R957 |
T1676 |
T1675 |
prep |
to,map |
R958 |
T1677 |
T1676 |
pobj |
chromosome,to |
R959 |
T1678 |
T1677 |
nummod |
1,chromosome |
R96 |
T323 |
T321 |
conj |
713,874 |
R960 |
T1679 |
T1675 |
prep |
within,map |
R961 |
T1680 |
T1681 |
nummod |
one,clone |
R962 |
T1681 |
T1679 |
pobj |
clone,within |
R963 |
T1682 |
T1681 |
compound |
BAC,clone |
R964 |
T1683 |
T1684 |
punct |
(,294I17 |
R965 |
T1684 |
T1681 |
parataxis |
294I17,clone |
R966 |
T1685 |
T1684 |
compound |
RP23,294I17 |
R967 |
T1686 |
T1684 |
punct |
-,294I17 |
R968 |
T1687 |
T1684 |
punct |
),294I17 |
R969 |
T1688 |
T1681 |
punct |
", ",clone |
R97 |
T324 |
T323 |
cc |
and,713 |
R970 |
T1689 |
T1681 |
amod |
proximal,clone |
R971 |
T1690 |
T1689 |
prep |
to,proximal |
R972 |
T1691 |
T1692 |
compound |
marker,D1Mit171 |
R973 |
T1692 |
T1690 |
pobj |
D1Mit171,to |
R974 |
T1693 |
T1694 |
punct |
(,cR |
R975 |
T1694 |
T1692 |
parataxis |
cR,D1Mit171 |
R976 |
T1695 |
T1694 |
nummod |
17.4,cR |
R977 |
T1696 |
T1694 |
punct |
),cR |
R978 |
T1697 |
T1675 |
punct |
.,map |
R979 |
T1699 |
T1700 |
det |
These,regions |
R98 |
T325 |
T323 |
conj |
771,713 |
R980 |
T1700 |
T1701 |
nsubj |
regions,are |
R981 |
T1702 |
T1701 |
acomp |
syntenic,are |
R982 |
T1703 |
T1702 |
prep |
to,syntenic |
R983 |
T1704 |
T1705 |
det |
the,counterparts |
R984 |
T1705 |
T1703 |
pobj |
counterparts,to |
R985 |
T1706 |
T1705 |
amod |
human,counterparts |
R986 |
T1707 |
T1701 |
punct |
.,are |
R987 |
T2019 |
T2020 |
compound |
Sequence,homology |
R988 |
T2021 |
T2020 |
cc |
and,homology |
R989 |
T2022 |
T2023 |
amod |
molecular,characteristics |
R99 |
T326 |
T319 |
compound |
amino,acids |
R990 |
T2023 |
T2020 |
conj |
characteristics,homology |
R991 |
T2025 |
T2026 |
det |
The,genes |
R992 |
T2026 |
T2029 |
nsubj |
genes,showed |
R993 |
T2027 |
T2026 |
compound |
mouse,genes |
R994 |
T2028 |
T2026 |
compound |
Acdp,genes |
R995 |
T2030 |
T2031 |
advmod |
very,strong |
R996 |
T2031 |
T2032 |
amod |
strong,homologies |
R997 |
T2032 |
T2029 |
dobj |
homologies,showed |
R998 |
T2033 |
T2032 |
prep |
of,homologies |
R999 |
T2034 |
T2035 |
preconj |
both,nucleotide |