PMC:7258756 / 28202-29302 JSONTXT 7 Projects

Annnotations TAB TSV DIC JSON TextAE

Id Subject Object Predicate Lexical cue
T183 0-130 Sentence denotes Supplementary Table IV Conformational B-cell epitopes predicted using the modelled structure of the spike protein (template used:
T184 131-241 Sentence denotes 6ACC.PDB; 87.29% identity). (A) Ellipro server (using a protusion Index threshold of 0.9) (B) DiscoTope server
T185 242-244 Sentence denotes A.
T186 245-271 Sentence denotes Ellipro epitope prediction
T187 272-319 Sentence denotes Epitope number Epitope residues Epitope score
T188 320-350 Sentence denotes 1 244-RSYLTPGDSSSGW-256 0.95
T189 351-454 Sentence denotes 2 347S, 349Y, 419Y, 441-SKVGGNYNYLYRLFR-455, 457S, 465-DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN -499 0.943
T190 455-551 Sentence denotes 3 1074 TTAPAICHDGKAHFPR 1089, 1094-VSNGTHWFV-1102, 1110- PQIITTDNTFVSGNCDVVIGIVNNTV-1135 0.934
T191 552-581 Sentence denotes 4 144-HKNNKSWMESE-154 0.912
T192 582-604 Sentence denotes 5 72-GTNGTK-77 0.907
T193 605-607 Sentence denotes B.
T194 608-636 Sentence denotes DiscoTope epitope prediction