
PMC:7258756 / 28202-29302
Annnotations
LitCovid-PubTator
Id | Subject | Object | Predicate | Lexical cue | tao:has_database_id |
---|---|---|---|---|---|
343 | 101-106 | Gene | denotes | spike | Gene:43740568 |
LitCovid-PD-FMA-UBERON
Id | Subject | Object | Predicate | Lexical cue | fma_id |
---|---|---|---|---|---|
T109 | 41-45 | Body_part | denotes | cell | http://purl.org/sig/ont/fma/fma68646 |
T110 | 107-114 | Body_part | denotes | protein | http://purl.org/sig/ont/fma/fma67257 |
LitCovid-PD-CLO
Id | Subject | Object | Predicate | Lexical cue |
---|---|---|---|---|
T159 | 39-45 | http://purl.obolibrary.org/obo/CL_0000236 | denotes | B-cell |
T160 | 160-161 | http://purl.obolibrary.org/obo/CLO_0001020 | denotes | A |
T161 | 185-186 | http://purl.obolibrary.org/obo/CLO_0001020 | denotes | a |
T162 | 222-223 | http://purl.obolibrary.org/obo/CLO_0001021 | denotes | B |
T163 | 242-243 | http://purl.obolibrary.org/obo/CLO_0001020 | denotes | A |
T164 | 320-326 | http://purl.obolibrary.org/obo/CLO_0001054 | denotes | 1 244 |
T165 | 392-395 | http://purl.obolibrary.org/obo/CLO_0001375 | denotes | 455 |
T166 | 403-406 | http://purl.obolibrary.org/obo/CLO_0001379 | denotes | 465 |
T167 | 605-606 | http://purl.obolibrary.org/obo/CLO_0001021 | denotes | B |
T168 | 1034-1038 | http://purl.obolibrary.org/obo/CLO_0001609 | denotes | A704 |
LitCovid-PD-CHEBI
Id | Subject | Object | Predicate | Lexical cue | chebi_id |
---|---|---|---|---|---|
T115 | 20-22 | Chemical | denotes | IV | http://purl.obolibrary.org/obo/CHEBI_74327 |
T116 | 107-114 | Chemical | denotes | protein | http://purl.obolibrary.org/obo/CHEBI_36080 |
T117 | 253-260 | Chemical | denotes | epitope | http://purl.obolibrary.org/obo/CHEBI_53000 |
T118 | 618-625 | Chemical | denotes | epitope | http://purl.obolibrary.org/obo/CHEBI_53000 |
LitCovid-PD-GlycoEpitope
Id | Subject | Object | Predicate | Lexical cue | glyco_epitope_db_id |
---|---|---|---|---|---|
T4 | 637-640 | GlycoEpitope | denotes | G72 | http://www.glycoepitope.jp/epitopes/AN0029 |
LitCovid-sentences
Id | Subject | Object | Predicate | Lexical cue |
---|---|---|---|---|
T183 | 0-130 | Sentence | denotes | Supplementary Table IV Conformational B-cell epitopes predicted using the modelled structure of the spike protein (template used: |
T184 | 131-241 | Sentence | denotes | 6ACC.PDB; 87.29% identity). (A) Ellipro server (using a protusion Index threshold of 0.9) (B) DiscoTope server |
T185 | 242-244 | Sentence | denotes | A. |
T186 | 245-271 | Sentence | denotes | Ellipro epitope prediction |
T187 | 272-319 | Sentence | denotes | Epitope number Epitope residues Epitope score |
T188 | 320-350 | Sentence | denotes | 1 244-RSYLTPGDSSSGW-256 0.95 |
T189 | 351-454 | Sentence | denotes | 2 347S, 349Y, 419Y, 441-SKVGGNYNYLYRLFR-455, 457S, 465-DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN -499 0.943 |
T190 | 455-551 | Sentence | denotes | 3 1074 TTAPAICHDGKAHFPR 1089, 1094-VSNGTHWFV-1102, 1110- PQIITTDNTFVSGNCDVVIGIVNNTV-1135 0.934 |
T191 | 552-581 | Sentence | denotes | 4 144-HKNNKSWMESE-154 0.912 |
T192 | 582-604 | Sentence | denotes | 5 72-GTNGTK-77 0.907 |
T193 | 605-607 | Sentence | denotes | B. |
T194 | 608-636 | Sentence | denotes | DiscoTope epitope prediction |