> top > docs > PMC:7258756 > spans > 28202-29302 > annotations

PMC:7258756 / 28202-29302 JSONTXT

Annnotations TAB JSON ListView MergeView

LitCovid-PubTator

Id Subject Object Predicate Lexical cue tao:has_database_id
343 101-106 Gene denotes spike Gene:43740568

LitCovid-PD-FMA-UBERON

Id Subject Object Predicate Lexical cue fma_id
T109 41-45 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T110 107-114 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257

LitCovid-PD-CLO

Id Subject Object Predicate Lexical cue
T159 39-45 http://purl.obolibrary.org/obo/CL_0000236 denotes B-cell
T160 160-161 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T161 185-186 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T162 222-223 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T163 242-243 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T164 320-326 http://purl.obolibrary.org/obo/CLO_0001054 denotes 1 244
T165 392-395 http://purl.obolibrary.org/obo/CLO_0001375 denotes 455
T166 403-406 http://purl.obolibrary.org/obo/CLO_0001379 denotes 465
T167 605-606 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T168 1034-1038 http://purl.obolibrary.org/obo/CLO_0001609 denotes A704

LitCovid-PD-CHEBI

Id Subject Object Predicate Lexical cue chebi_id
T115 20-22 Chemical denotes IV http://purl.obolibrary.org/obo/CHEBI_74327
T116 107-114 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T117 253-260 Chemical denotes epitope http://purl.obolibrary.org/obo/CHEBI_53000
T118 618-625 Chemical denotes epitope http://purl.obolibrary.org/obo/CHEBI_53000

LitCovid-PD-GlycoEpitope

Id Subject Object Predicate Lexical cue glyco_epitope_db_id
T4 637-640 GlycoEpitope denotes G72 http://www.glycoepitope.jp/epitopes/AN0029

LitCovid-sentences

Id Subject Object Predicate Lexical cue
T183 0-130 Sentence denotes Supplementary Table IV Conformational B-cell epitopes predicted using the modelled structure of the spike protein (template used:
T184 131-241 Sentence denotes 6ACC.PDB; 87.29% identity). (A) Ellipro server (using a protusion Index threshold of 0.9) (B) DiscoTope server
T185 242-244 Sentence denotes A.
T186 245-271 Sentence denotes Ellipro epitope prediction
T187 272-319 Sentence denotes Epitope number Epitope residues Epitope score
T188 320-350 Sentence denotes 1 244-RSYLTPGDSSSGW-256 0.95
T189 351-454 Sentence denotes 2 347S, 349Y, 419Y, 441-SKVGGNYNYLYRLFR-455, 457S, 465-DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN -499 0.943
T190 455-551 Sentence denotes 3 1074 TTAPAICHDGKAHFPR 1089, 1094-VSNGTHWFV-1102, 1110- PQIITTDNTFVSGNCDVVIGIVNNTV-1135 0.934
T191 552-581 Sentence denotes 4 144-HKNNKSWMESE-154 0.912
T192 582-604 Sentence denotes 5 72-GTNGTK-77 0.907
T193 605-607 Sentence denotes B.
T194 608-636 Sentence denotes DiscoTope epitope prediction