> top > docs > PMC:7313968 > spans > 1284-1488 > annotations

PMC:7313968 / 1284-1488 JSONTXT

Annnotations TAB JSON ListView MergeView

LitCovid-PD-MONDO

Id Subject Object Predicate Lexical cue mondo_id
T8 81-89 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T9 193-201 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091

LitCovid-PD-CLO

Id Subject Object Predicate Lexical cue
T16 147-148 http://purl.obolibrary.org/obo/CLO_0001020 denotes a

LitCovid-PD-CHEBI

Id Subject Object Predicate Lexical cue chebi_id
T19 22-29 Chemical denotes glycans http://purl.obolibrary.org/obo/CHEBI_18154

LitCovid-PubTator

Id Subject Object Predicate Lexical cue tao:has_database_id
41 81-91 Species denotes SARS-CoV-2 Tax:2697049
42 193-201 Species denotes SARS-CoV Tax:694009
44 48-53 Gene denotes spike Gene:43740568
53 22-29 Chemical denotes glycans MESH:D011134

LitCovid-sentences

Id Subject Object Predicate Lexical cue
T12 0-204 Sentence denotes Electron densities of glycans cover most of the spike receptor-binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1.