> top > docs > PMC:7212236 > annotations

PMC:7212236 JSONTXT

Annnotations TAB JSON ListView MergeView

LitCovid_Glycan-Motif-Structure

Id Subject Object Predicate Lexical cue
T1 7534-7540 https://glytoucan.org/Structures/Glycans/G82576YO denotes fucose
T2 8076-8082 https://glytoucan.org/Structures/Glycans/G82576YO denotes fucose
T3 8911-8917 https://glytoucan.org/Structures/Glycans/G82576YO denotes fucose

LitCovid-PD-FMA-UBERON

Id Subject Object Predicate Lexical cue fma_id
T1 45-52 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T2 1838-1851 Body_part denotes interleukin 2 http://purl.org/sig/ont/fma/fma84051
T3 1838-1849 Body_part denotes interleukin http://purl.org/sig/ont/fma/fma86578
T4 1853-1857 Body_part denotes IL-2 http://purl.org/sig/ont/fma/fma84051
T5 1873-1884 Body_part denotes granulocyte http://purl.org/sig/ont/fma/fma62854
T6 1944-1951 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T7 1963-1971 Body_part denotes monocyte http://purl.org/sig/ont/fma/fma62864
T8 1988-1995 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T9 2006-2016 Body_part denotes macrophage http://purl.org/sig/ont/fma/fma63261
T10 2030-2037 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T11 2089-2095 Body_part denotes plasma http://purl.org/sig/ont/fma/fma62970
T12 2586-2592 Body_part denotes genome http://purl.org/sig/ont/fma/fma84116
T13 2623-2633 Body_part denotes nucleotide http://purl.org/sig/ont/fma/fma82740
T14 2947-2957 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T15 3055-3062 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T16 3125-3132 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T17 3143-3148 Body_part denotes helix http://purl.org/sig/ont/fma/fma60992
T18 3235-3241 Body_part denotes genome http://purl.org/sig/ont/fma/fma84116
T19 3250-3261 Body_part denotes nucleotides http://purl.org/sig/ont/fma/fma82740
T20 3353-3363 Body_part denotes nucleotide http://purl.org/sig/ont/fma/fma82740
T21 3622-3626 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T22 3953-3963 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T23 4026-4033 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T24 4566-4573 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T25 4632-4639 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T26 4673-4681 Body_part denotes proteins http://purl.org/sig/ont/fma/fma67257
T27 4769-4776 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T28 4904-4911 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T29 5587-5594 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T30 6249-6256 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T31 6362-6369 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T32 6438-6445 Body_part denotes Protein http://purl.org/sig/ont/fma/fma67257
T33 6865-6872 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T34 6937-6944 Body_part denotes Protein http://purl.org/sig/ont/fma/fma67257
T35 7363-7370 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T36 7534-7540 Body_part denotes fucose http://purl.org/sig/ont/fma/fma82790
T37 7830-7843 Body_part denotes phenylalanine http://purl.org/sig/ont/fma/fma82754
T38 7960-7967 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T39 8076-8082 Body_part denotes fucose http://purl.org/sig/ont/fma/fma82790
T40 8325-8338 Body_part denotes PHENYLALANINE http://purl.org/sig/ont/fma/fma82754
T41 8488-8495 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T42 8538-8545 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T43 8665-8673 Body_part denotes proteins http://purl.org/sig/ont/fma/fma67257
T44 8684-8691 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T45 8911-8917 Body_part denotes fucose http://purl.org/sig/ont/fma/fma82790
T46 9307-9317 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T47 9340-9347 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T48 9488-9495 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T49 9682-9689 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T50 9799-9806 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T51 9962-9969 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T52 10131-10138 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T53 10294-10301 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T54 10357-10367 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T55 10475-10482 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T56 10504-10514 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T57 10606-10613 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T58 10745-10752 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T59 10840-10847 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T60 10993-11000 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T61 11015-11022 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T62 11079-11089 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T63 11112-11116 Body_part denotes axis http://purl.org/sig/ont/fma/fma12520
T64 11150-11154 Body_part denotes axis http://purl.org/sig/ont/fma/fma12520
T65 11188-11195 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T66 11289-11296 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T67 11642-11649 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T68 11892-11899 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T69 11934-11941 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T70 12117-12124 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T71 12174-12181 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T72 12235-12242 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T73 12270-12277 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T74 12579-12586 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T75 12618-12625 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T76 13199-13206 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T77 13259-13267 Body_part denotes proteins http://purl.org/sig/ont/fma/fma67257
T78 13565-13572 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T79 13787-13794 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T80 13881-13888 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T81 13940-13947 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T82 15147-15157 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T83 15882-15889 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T84 15921-15928 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T85 16018-16025 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T86 16194-16201 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T87 16899-16909 Body_part denotes amino acid http://purl.org/sig/ont/fma/fma82739
T88 17103-17110 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T89 17317-17324 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T90 17419-17422 Body_part denotes RNA http://purl.org/sig/ont/fma/fma67095
T91 17961-17964 Body_part denotes RNA http://purl.org/sig/ont/fma/fma67095
T92 18043-18050 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T93 18132-18139 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T94 18166-18173 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T95 18276-18280 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T96 18368-18382 Body_part denotes cell membranes http://purl.org/sig/ont/fma/fma63841
T97 18368-18372 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T98 18434-18438 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T99 18479-18486 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T100 18633-18640 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257
T101 18853-18857 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T102 18953-18967 Body_part denotes cell membranes http://purl.org/sig/ont/fma/fma63841
T103 18953-18957 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T104 19047-19051 Body_part denotes cell http://purl.org/sig/ont/fma/fma68646
T105 19805-19812 Body_part denotes protein http://purl.org/sig/ont/fma/fma67257

LitCovid-PD-UBERON

Id Subject Object Predicate Lexical cue uberon_id
T1 3143-3148 Body_part denotes helix http://purl.obolibrary.org/obo/UBERON_0002488

LitCovid-PD-MONDO

Id Subject Object Predicate Lexical cue mondo_id
T1 63-71 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T2 101-109 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T3 216-240 Disease denotes coronavirus disease 2019 http://purl.obolibrary.org/obo/MONDO_0100096
T4 242-250 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T5 377-385 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T6 543-551 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T7 651-659 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T8 1221-1229 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T9 1305-1313 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T10 1575-1583 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T11 1587-1595 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T12 1640-1649 Disease denotes pneumonia http://purl.obolibrary.org/obo/MONDO_0005249
T13 1714-1738 Disease denotes coronavirus disease 2019 http://purl.obolibrary.org/obo/MONDO_0100096
T14 1740-1748 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T15 1751-1759 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T16 2054-2059 Disease denotes tumor http://purl.obolibrary.org/obo/MONDO_0005070
T17 2226-2234 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T18 2238-2285 Disease denotes severe acute respiratory syndrome coronavirus 2 http://purl.obolibrary.org/obo/MONDO_0100096
T19 2238-2271 Disease denotes severe acute respiratory syndrome http://purl.obolibrary.org/obo/MONDO_0005091
T20 2436-2444 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T21 2446-2479 Disease denotes severe acute respiratory syndrome http://purl.obolibrary.org/obo/MONDO_0005091
T22 2498-2506 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T23 2596-2604 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T24 2654-2658 Disease denotes SARS http://purl.obolibrary.org/obo/MONDO_0005091
T25 2686-2694 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T26 2795-2803 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T27 2868-2876 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T28 2928-2936 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T29 2980-2984 Disease denotes SARS http://purl.obolibrary.org/obo/MONDO_0005091
T30 3022-3030 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T31 3086-3094 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T32 3310-3318 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T33 3390-3394 Disease denotes SARS http://purl.obolibrary.org/obo/MONDO_0005091
T34 3597-3605 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T35 3654-3662 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T36 3819-3827 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T37 4001-4010 Disease denotes pneumonia http://purl.obolibrary.org/obo/MONDO_0005249
T38 4187-4191 Disease denotes SARS http://purl.obolibrary.org/obo/MONDO_0005091
T39 4193-4226 Disease denotes severe acute respiratory syndrome http://purl.obolibrary.org/obo/MONDO_0005091
T40 4274-4319 Disease denotes porcine reproductive and respiratory syndrome http://purl.obolibrary.org/obo/MONDO_0025494
T41 4948-4956 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T42 5630-5638 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T43 10982-10990 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T44 11332-11340 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T45 11685-11693 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T46 11914-11922 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T47 12135-12143 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T48 12313-12321 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T49 12661-12669 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T50 12684-12731 Disease denotes Severe acute respiratory syndrome coronavirus 2 http://purl.obolibrary.org/obo/MONDO_0100096
T51 12733-12741 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T52 12781-12789 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T53 12916-12940 Disease denotes coronavirus disease-2019 http://purl.obolibrary.org/obo/MONDO_0100096
T54 12942-12950 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T55 13061-13069 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T56 13093-13126 Disease denotes severe acute respiratory syndrome http://purl.obolibrary.org/obo/MONDO_0005091
T57 13336-13369 Disease denotes severe acute respiratory syndrome http://purl.obolibrary.org/obo/MONDO_0005091
T58 13523-13531 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T59 13608-13616 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T60 14349-14357 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T61 14472-14480 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T62 15997-16005 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T63 16224-16232 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T64 17972-17980 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T65 18403-18413 Disease denotes infectious http://purl.obolibrary.org/obo/MONDO_0005550
T66 18459-18467 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T67 18651-18659 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T68 18694-18702 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T69 19016-19026 Disease denotes infectious http://purl.obolibrary.org/obo/MONDO_0005550
T70 19096-19104 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T71 19138-19146 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T72 19149-19158 Disease denotes infection http://purl.obolibrary.org/obo/MONDO_0005550
T73 19476-19485 Disease denotes influenza http://purl.obolibrary.org/obo/MONDO_0005812
T74 19548-19583 Disease denotes acute respiratory distress syndrome http://purl.obolibrary.org/obo/MONDO_0006502
T75 19554-19583 Disease denotes respiratory distress syndrome http://purl.obolibrary.org/obo/MONDO_0009971
T76 19664-19672 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T77 19714-19722 Disease denotes COVID-19 http://purl.obolibrary.org/obo/MONDO_0100096
T78 19874-19882 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091
T79 20061-20069 Disease denotes SARS-CoV http://purl.obolibrary.org/obo/MONDO_0005091

LitCovid-PD-CLO

Id Subject Object Predicate Lexical cue
T1 260-265 http://purl.obolibrary.org/obo/NCBITaxon_9606 denotes human
T2 269-274 http://purl.obolibrary.org/obo/NCBITaxon_9606 denotes human
T3 289-290 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T4 465-466 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T5 1420-1421 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T6 1532-1533 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T7 1665-1666 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T8 1788-1789 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T9 1838-1851 http://purl.obolibrary.org/obo/PR_000001379 denotes interleukin 2
T10 1853-1857 http://purl.obolibrary.org/obo/PR_000001379 denotes IL-2
T11 1873-1910 http://purl.obolibrary.org/obo/PR_000005932 denotes granulocyte colony-stimulating factor
T12 1912-1916 http://purl.obolibrary.org/obo/PR_000005932 denotes GCSF
T13 1919-1935 http://purl.obolibrary.org/obo/PR_000000017 denotes interferon gamma
T14 1963-1971 http://purl.obolibrary.org/obo/CL_0000576 denotes monocyte
T15 2076-2077 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T16 2083-2084 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T17 2089-2095 http://purl.obolibrary.org/obo/UBERON_0001969 denotes plasma
T18 2301-2302 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T19 2570-2576 http://purl.obolibrary.org/obo/NCBITaxon_9606 denotes humans
T20 2607-2610 http://purl.obolibrary.org/obo/CLO_0051582 denotes has
T21 2650-2653 http://purl.obolibrary.org/obo/NCBITaxon_9397 denotes bat
T22 2680-2685 http://purl.obolibrary.org/obo/NCBITaxon_9606 denotes human
T23 2743-2751 http://purl.obolibrary.org/obo/UBERON_0000158 denotes membrane
T24 2769-2770 http://purl.obolibrary.org/obo/CLO_0001021 denotes b
T25 2846-2849 http://purl.obolibrary.org/obo/NCBITaxon_9397 denotes bat
T26 2862-2867 http://purl.obolibrary.org/obo/NCBITaxon_9606 denotes human
T27 2939-2942 http://purl.obolibrary.org/obo/CLO_0051582 denotes has
T28 3041-3042 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T29 3114-3115 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T30 3141-3142 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T31 3150-3151 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T32 3152-3153 http://purl.obolibrary.org/obo/CLO_0001021 denotes b
T33 3280-3285 http://purl.obolibrary.org/obo/NCBITaxon_9606 denotes Human
T34 3379-3380 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T35 3495-3499 http://purl.obolibrary.org/obo/NCBITaxon_9397 denotes bats
T36 3523-3524 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T37 3563-3564 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T38 3622-3626 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T39 4011-4016 http://purl.obolibrary.org/obo/NCBITaxon_10239 denotes virus
T40 4515-4517 http://purl.obolibrary.org/obo/CLO_0053733 denotes 11
T41 4704-4705 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T42 4754-4755 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T43 4860-4861 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T44 5388-5390 http://purl.obolibrary.org/obo/CLO_0050510 denotes 18
T45 5557-5558 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T46 5681-5687 http://purl.obolibrary.org/obo/CLO_0001658 denotes active
T47 6360-6361 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T48 6485-6491 http://purl.obolibrary.org/obo/CLO_0007535 denotes Marvin
T49 6555-6558 http://purl.obolibrary.org/obo/PR_000001343 denotes aim
T50 6776-6777 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T51 6841-6847 http://purl.obolibrary.org/obo/CLO_0001658 denotes active
T52 7022-7024 http://purl.obolibrary.org/obo/CLO_0002857 denotes E1
T53 7058-7060 http://purl.obolibrary.org/obo/CLO_0002860 denotes E2
T54 7065-7069 http://purl.obolibrary.org/obo/CLO_0001407 denotes 5 2
T55 7094-7096 http://purl.obolibrary.org/obo/CLO_0002861 denotes E3
T56 7101-7105 http://purl.obolibrary.org/obo/CLO_0053799 denotes 4 5
T57 7137-7141 http://purl.obolibrary.org/obo/CLO_0053799 denotes 4 5
T58 7194-7202 http://purl.obolibrary.org/obo/CLO_0051389 denotes N1 4 5
T59 7230-7235 http://purl.obolibrary.org/obo/CLO_0007926 denotes N2 2
T60 7237-7241 http://purl.obolibrary.org/obo/CLO_0001407 denotes 5 2
T61 7271-7275 http://purl.obolibrary.org/obo/CLO_0001000 denotes 3 5
T62 7525-7527 http://purl.obolibrary.org/obo/CLO_0002857 denotes E1
T63 7530-7531 http://purl.obolibrary.org/obo/CLO_0001021 denotes b
T64 7542-7544 http://purl.obolibrary.org/obo/CLO_0002860 denotes E2
T65 7566-7568 http://purl.obolibrary.org/obo/CLO_0002861 denotes E3
T66 7826-7828 http://purl.obolibrary.org/obo/CLO_0008285 denotes P1
T67 8072-8073 http://purl.obolibrary.org/obo/CLO_0001021 denotes b
T68 8907-8908 http://purl.obolibrary.org/obo/CLO_0001021 denotes b
T69 9268-9270 http://purl.obolibrary.org/obo/CLO_0008285 denotes P1
T70 9518-9519 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T71 9575-9576 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T72 9638-9639 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T73 10208-10209 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T74 10357-10375 http://purl.obolibrary.org/obo/CHEBI_33708 denotes amino acid residue
T75 10357-10375 http://purl.obolibrary.org/obo/PR_000036907 denotes amino acid residue
T76 10504-10523 http://purl.obolibrary.org/obo/CHEBI_33708 denotes amino acid residues
T77 10504-10523 http://purl.obolibrary.org/obo/PR_000036907 denotes amino acid residues
T78 10723-10724 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T79 10763-10764 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T80 10887-10889 http://purl.obolibrary.org/obo/CLO_0001527 denotes 94
T81 10922-10923 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T82 10925-10926 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T83 11002-11003 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T84 11024-11025 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T85 11079-11098 http://purl.obolibrary.org/obo/CHEBI_33708 denotes amino acid residues
T86 11079-11098 http://purl.obolibrary.org/obo/PR_000036907 denotes amino acid residues
T87 11481-11487 http://purl.obolibrary.org/obo/CLO_0001658 denotes active
T88 11578-11580 http://purl.obolibrary.org/obo/CLO_0002857 denotes E1
T89 11785-11787 http://purl.obolibrary.org/obo/CLO_0002860 denotes E2
T90 11951-11954 http://purl.obolibrary.org/obo/CLO_0001236 denotes 2 A
T91 11956-11957 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T92 12325-12327 http://purl.obolibrary.org/obo/CLO_0002860 denotes E2
T93 12335-12338 http://purl.obolibrary.org/obo/CLO_0051582 denotes has
T94 12435-12438 http://purl.obolibrary.org/obo/CLO_0051582 denotes has
T95 12566-12571 http://purl.obolibrary.org/obo/CLO_0001296 denotes 3 2D
T96 12566-12571 http://purl.obolibrary.org/obo/CLO_0051044 denotes 3 2D
T97 12748-12749 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T98 12810-12811 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T99 12855-12856 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T100 13127-13132 http://purl.obolibrary.org/obo/NCBITaxon_10239 denotes virus
T101 13143-13145 http://purl.obolibrary.org/obo/CLO_0050509 denotes 27
T102 13316-13319 http://purl.obolibrary.org/obo/NCBITaxon_9397 denotes bat
T103 13751-13752 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T104 13785-13786 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T105 14628-14630 http://purl.obolibrary.org/obo/CLO_0053733 denotes 11
T106 14994-14995 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T107 15041-15042 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T108 15244-15245 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T109 15930-15931 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T110 15966-15967 http://purl.obolibrary.org/obo/CLO_0001021 denotes B
T111 16380-16382 http://purl.obolibrary.org/obo/CLO_0053733 denotes 11
T112 16746-16747 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T113 16793-16794 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T114 16996-16997 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T115 17288-17289 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T116 17377-17385 http://purl.obolibrary.org/obo/UBERON_0000158 denotes membrane
T117 17575-17577 http://purl.obolibrary.org/obo/CLO_0001302 denotes 34
T118 17716-17726 http://purl.obolibrary.org/obo/CLO_0001658 denotes activities
T119 17911-17919 http://purl.obolibrary.org/obo/UBERON_0000158 denotes membrane
T120 18057-18058 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T121 18097-18102 http://purl.obolibrary.org/obo/NCBITaxon_10239 denotes virus
T122 18123-18131 http://purl.obolibrary.org/obo/UBERON_0000158 denotes membrane
T123 18276-18280 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T124 18368-18372 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T125 18373-18382 http://purl.obolibrary.org/obo/UBERON_0000158 denotes membranes
T126 18414-18419 http://purl.obolibrary.org/obo/NCBITaxon_10239 denotes virus
T127 18434-18438 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T128 18443-18445 http://purl.obolibrary.org/obo/CLO_0001000 denotes 35
T129 18692-18693 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T130 18827-18832 http://purl.obolibrary.org/obo/NCBITaxon_10239 denotes virus
T131 18853-18857 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T132 18953-18957 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T133 18958-18967 http://purl.obolibrary.org/obo/UBERON_0000158 denotes membranes
T134 19027-19032 http://purl.obolibrary.org/obo/NCBITaxon_10239 denotes virus
T135 19047-19051 http://purl.obolibrary.org/obo/GO_0005623 denotes cell
T136 19433-19434 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T137 19627-19629 http://purl.obolibrary.org/obo/CLO_0001313 denotes 36
T138 19886-19887 http://purl.obolibrary.org/obo/CLO_0001020 denotes A
T139 20018-20019 http://purl.obolibrary.org/obo/CLO_0001020 denotes a
T140 20353-20355 http://purl.obolibrary.org/obo/CLO_0007860 denotes Mr
T141 20381-20383 http://purl.obolibrary.org/obo/CLO_0007860 denotes Mr

LitCovid-PD-CHEBI

Id Subject Object Predicate Lexical cue chebi_id
T1 45-52 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T2 53-59 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T3 337-342 Chemical denotes drugs http://purl.obolibrary.org/obo/CHEBI_23888
T4 527-534 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T5 719-726 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T6 753-760 Chemical denotes octanol http://purl.obolibrary.org/obo/CHEBI_37868
T7 761-766 Chemical denotes water http://purl.obolibrary.org/obo/CHEBI_15377
T8 805-813 Chemical denotes hydrogen http://purl.obolibrary.org/obo/CHEBI_49637
T9 907-913 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T10 970-976 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T11 995-1012 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T12 1008-1012 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T13 1028-1030 Chemical denotes DG http://purl.obolibrary.org/obo/CHEBI_73450
T14 1124-1130 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T16 1131-1139 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T18 1144-1161 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T19 1157-1161 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T20 1178-1180 Chemical denotes DG http://purl.obolibrary.org/obo/CHEBI_73450
T21 1447-1454 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T22 1534-1538 Chemical denotes drug http://purl.obolibrary.org/obo/CHEBI_23888
T23 1667-1672 Chemical denotes group http://purl.obolibrary.org/obo/CHEBI_24433
T24 1853-1855 Chemical denotes IL http://purl.obolibrary.org/obo/CHEBI_63895|http://purl.obolibrary.org/obo/CHEBI_74072
T26 1860-1862 Chemical denotes IL http://purl.obolibrary.org/obo/CHEBI_63895|http://purl.obolibrary.org/obo/CHEBI_74072
T28 1866-1868 Chemical denotes IL http://purl.obolibrary.org/obo/CHEBI_63895|http://purl.obolibrary.org/obo/CHEBI_74072
T30 1919-1954 Chemical denotes interferon gamma-induced protein 10 http://purl.obolibrary.org/obo/CHEBI_138157
T31 1919-1929 Chemical denotes interferon http://purl.obolibrary.org/obo/CHEBI_52999
T32 1930-1935 Chemical denotes gamma http://purl.obolibrary.org/obo/CHEBI_30212
T33 1944-1951 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T34 1988-1995 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T35 2030-2037 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T36 2132-2136 Chemical denotes beta http://purl.obolibrary.org/obo/CHEBI_10545
T37 2199-2203 Chemical denotes beta http://purl.obolibrary.org/obo/CHEBI_10545
T38 2623-2633 Chemical denotes nucleotide http://purl.obolibrary.org/obo/CHEBI_36976
T39 2947-2957 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T40 2947-2952 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T41 2953-2957 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T42 3055-3062 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T43 3125-3132 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T44 3250-3261 Chemical denotes nucleotides http://purl.obolibrary.org/obo/CHEBI_36976
T45 3353-3363 Chemical denotes nucleotide http://purl.obolibrary.org/obo/CHEBI_36976
T46 3381-3386 Chemical denotes group http://purl.obolibrary.org/obo/CHEBI_24433
T47 3800-3806 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T48 3953-3963 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T49 3953-3958 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T50 3959-3963 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T51 4026-4033 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T52 4566-4573 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T53 4632-4639 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T54 4673-4681 Chemical denotes proteins http://purl.obolibrary.org/obo/CHEBI_36080
T55 4769-4776 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T56 4904-4911 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T57 5587-5594 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T58 5901-5907 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T59 5945-5951 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T60 6092-6099 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T61 6229-6236 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T62 6249-6256 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T63 6362-6369 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T64 6438-6445 Chemical denotes Protein http://purl.obolibrary.org/obo/CHEBI_16541
T65 6512-6519 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T66 6739-6745 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T67 6746-6755 Chemical denotes molecules http://purl.obolibrary.org/obo/CHEBI_25367
T68 6826-6833 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T69 6865-6872 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T70 6937-6944 Chemical denotes Protein http://purl.obolibrary.org/obo/CHEBI_16541
T71 6988-6990 Chemical denotes DG http://purl.obolibrary.org/obo/CHEBI_73450
T72 7230-7232 Chemical denotes N2 http://purl.obolibrary.org/obo/CHEBI_17997
T73 7363-7370 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T74 7371-7377 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T75 7385-7393 Chemical denotes hydrogen http://purl.obolibrary.org/obo/CHEBI_49637
T76 7416-7424 Chemical denotes hydrogen http://purl.obolibrary.org/obo/CHEBI_49637
T77 7454-7461 Chemical denotes octanol http://purl.obolibrary.org/obo/CHEBI_37868
T78 7462-7467 Chemical denotes water http://purl.obolibrary.org/obo/CHEBI_15377
T79 7534-7540 Chemical denotes fucose http://purl.obolibrary.org/obo/CHEBI_33984
T80 7547-7564 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T81 7560-7564 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T82 7571-7586 Chemical denotes castanospermine http://purl.obolibrary.org/obo/CHEBI_27860
T83 7642-7648 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T85 7649-7657 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T87 7662-7679 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T88 7675-7679 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T89 7681-7683 Chemical denotes N2 http://purl.obolibrary.org/obo/CHEBI_17997
T90 7714-7720 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T92 7721-7729 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T94 7734-7751 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T95 7747-7751 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T96 7782-7788 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T98 7789-7797 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T100 7802-7819 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T101 7815-7819 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T102 7826-7828 Chemical denotes P1 http://purl.obolibrary.org/obo/CHEBI_60949
T103 7830-7843 Chemical denotes phenylalanine http://purl.obolibrary.org/obo/CHEBI_28044|http://purl.obolibrary.org/obo/CHEBI_58095
T105 7926-7935 Chemical denotes antiviral http://purl.obolibrary.org/obo/CHEBI_22587
T106 7936-7945 Chemical denotes molecules http://purl.obolibrary.org/obo/CHEBI_25367
T107 7960-7967 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T108 8064-8070 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T109 8074-8082 Chemical denotes D-fucose http://purl.obolibrary.org/obo/CHEBI_2179|http://purl.obolibrary.org/obo/CHEBI_28847
T111 8076-8082 Chemical denotes fucose http://purl.obolibrary.org/obo/CHEBI_33984
T112 8084-8101 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T113 8097-8101 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T114 8103-8118 Chemical denotes castanospermine http://purl.obolibrary.org/obo/CHEBI_27860
T115 8157-8163 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T117 8164-8172 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T119 8177-8194 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T120 8190-8194 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T121 8219-8225 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T123 8226-8234 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T125 8239-8256 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T126 8252-8256 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T127 8278-8284 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T129 8285-8293 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T131 8298-8315 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T132 8311-8315 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T133 8325-8338 Chemical denotes PHENYLALANINE http://purl.obolibrary.org/obo/CHEBI_17295
T134 8339-8343 Chemical denotes atom http://purl.obolibrary.org/obo/CHEBI_33250
T135 8408-8410 Chemical denotes dG http://purl.obolibrary.org/obo/CHEBI_17172
T136 8438-8440 Chemical denotes dG http://purl.obolibrary.org/obo/CHEBI_17172
T137 8450-8456 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T138 8488-8495 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T139 8507-8514 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T140 8538-8545 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T141 8564-8571 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T142 8653-8660 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T143 8665-8673 Chemical denotes proteins http://purl.obolibrary.org/obo/CHEBI_36080
T144 8684-8691 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T145 8909-8917 Chemical denotes D-fucose http://purl.obolibrary.org/obo/CHEBI_2179|http://purl.obolibrary.org/obo/CHEBI_28847
T147 8911-8917 Chemical denotes fucose http://purl.obolibrary.org/obo/CHEBI_33984
T148 8919-8936 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T149 8932-8936 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T150 8938-8953 Chemical denotes castanospermine http://purl.obolibrary.org/obo/CHEBI_27860
T151 8978-8985 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T152 9268-9270 Chemical denotes P1 http://purl.obolibrary.org/obo/CHEBI_60949
T153 9271-9278 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T154 9307-9317 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T155 9307-9312 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T156 9313-9317 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T157 9340-9347 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T158 9488-9495 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T159 9682-9689 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T160 9799-9806 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T161 9962-9969 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T162 10131-10138 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T163 10294-10301 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T164 10357-10375 Chemical denotes amino acid residue http://purl.obolibrary.org/obo/CHEBI_33708
T165 10357-10367 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T166 10357-10362 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T167 10363-10367 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T168 10475-10482 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T169 10504-10514 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T170 10504-10509 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T171 10510-10514 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T172 10606-10613 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T173 10745-10752 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T174 10840-10847 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T175 10993-11000 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T176 11015-11022 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T177 11079-11089 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T178 11079-11084 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T179 11085-11089 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T180 11188-11195 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T181 11289-11296 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T182 11507-11514 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T183 11569-11576 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T184 11642-11649 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T185 11789-11806 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T186 11802-11806 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T187 11822-11824 Chemical denotes DG http://purl.obolibrary.org/obo/CHEBI_73450
T188 11892-11899 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T189 11900-11906 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T190 11934-11941 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T191 11966-11968 Chemical denotes N2 http://purl.obolibrary.org/obo/CHEBI_17997
T192 11993-11999 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T194 12000-12008 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T196 12013-12030 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T197 12026-12030 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T198 12047-12049 Chemical denotes DG http://purl.obolibrary.org/obo/CHEBI_73450
T199 12117-12124 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T200 12125-12131 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T201 12174-12181 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T202 12235-12242 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T203 12243-12249 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T204 12270-12277 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T205 12328-12334 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T206 12344-12352 Chemical denotes hydrogen http://purl.obolibrary.org/obo/CHEBI_49637
T207 12432-12434 Chemical denotes N2 http://purl.obolibrary.org/obo/CHEBI_17997
T208 12443-12451 Chemical denotes hydrogen http://purl.obolibrary.org/obo/CHEBI_49637
T209 12468-12471 Chemical denotes Thr http://purl.obolibrary.org/obo/CHEBI_16857|http://purl.obolibrary.org/obo/CHEBI_30013
T211 12522-12527 Chemical denotes arene http://purl.obolibrary.org/obo/CHEBI_33658
T212 12528-12533 Chemical denotes arene http://purl.obolibrary.org/obo/CHEBI_33658
T213 12551-12554 Chemical denotes Tyr http://purl.obolibrary.org/obo/CHEBI_17895|http://purl.obolibrary.org/obo/CHEBI_18186|http://purl.obolibrary.org/obo/CHEBI_46858
T216 12579-12586 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T217 12587-12593 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T218 12618-12625 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T219 12899-12904 Chemical denotes group http://purl.obolibrary.org/obo/CHEBI_24433
T220 13199-13206 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T221 13259-13267 Chemical denotes proteins http://purl.obolibrary.org/obo/CHEBI_36080
T222 13453-13460 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T223 13565-13572 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T224 13753-13759 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T225 13787-13794 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T226 13881-13888 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T227 13940-13947 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T228 13949-13966 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T229 13962-13966 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T230 14017-14023 Chemical denotes phenyl http://purl.obolibrary.org/obo/CHEBI_30396
T231 14024-14030 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T233 14031-14039 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T235 14044-14061 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T236 14057-14061 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T237 14080-14087 Chemical denotes octanol http://purl.obolibrary.org/obo/CHEBI_37868
T238 14088-14093 Chemical denotes water http://purl.obolibrary.org/obo/CHEBI_15377
T239 14140-14148 Chemical denotes hydrogen http://purl.obolibrary.org/obo/CHEBI_49637
T240 14214-14216 Chemical denotes DG http://purl.obolibrary.org/obo/CHEBI_73450
T241 14247-14253 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T242 15147-15157 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T243 15147-15152 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T244 15153-15157 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T245 15882-15889 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T246 15921-15928 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T247 16018-16025 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T248 16194-16201 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T249 16899-16909 Chemical denotes amino acid http://purl.obolibrary.org/obo/CHEBI_33709
T250 16899-16904 Chemical denotes amino http://purl.obolibrary.org/obo/CHEBI_46882
T251 16905-16909 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T252 17103-17110 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T253 17317-17324 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T254 17640-17646 Chemical denotes methyl http://purl.obolibrary.org/obo/CHEBI_32875|http://purl.obolibrary.org/obo/CHEBI_29309
T256 17647-17655 Chemical denotes pyrazole http://purl.obolibrary.org/obo/CHEBI_14973|http://purl.obolibrary.org/obo/CHEBI_17241
T258 17660-17677 Chemical denotes dicarboxylic acid http://purl.obolibrary.org/obo/CHEBI_35692
T259 17673-17677 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T260 18043-18050 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T261 18132-18139 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T262 18166-18173 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T263 18479-18486 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T264 18586-18603 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T265 18599-18603 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T266 18633-18640 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T267 18641-18647 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T268 18802-18819 Chemical denotes mycophenolic acid http://purl.obolibrary.org/obo/CHEBI_168396
T269 18815-18819 Chemical denotes acid http://purl.obolibrary.org/obo/CHEBI_37527
T270 19250-19256 Chemical denotes oxygen http://purl.obolibrary.org/obo/CHEBI_25805
T271 19277-19283 Chemical denotes oxygen http://purl.obolibrary.org/obo/CHEBI_25805
T272 19381-19394 Chemical denotes antimicrobial http://purl.obolibrary.org/obo/CHEBI_33281
T273 19417-19428 Chemical denotes antibiotics http://purl.obolibrary.org/obo/CHEBI_33281
T274 19435-19458 Chemical denotes neuraminidase inhibitor http://purl.obolibrary.org/obo/CHEBI_52425
T275 19449-19458 Chemical denotes inhibitor http://purl.obolibrary.org/obo/CHEBI_35222
T276 19639-19643 Chemical denotes drug http://purl.obolibrary.org/obo/CHEBI_23888
T277 19777-19783 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T278 19805-19812 Chemical denotes protein http://purl.obolibrary.org/obo/CHEBI_36080
T279 19828-19834 Chemical denotes ligand http://purl.obolibrary.org/obo/CHEBI_52214
T280 19913-19920 Chemical denotes ligands http://purl.obolibrary.org/obo/CHEBI_52214
T281 20020-20024 Chemical denotes drug http://purl.obolibrary.org/obo/CHEBI_23888

LitCovid-PD-GO-BP

Id Subject Object Predicate Lexical cue
T1 2060-2068 http://purl.obolibrary.org/obo/GO_0070265 denotes necrosis
T2 2060-2068 http://purl.obolibrary.org/obo/GO_0019835 denotes necrosis
T3 2060-2068 http://purl.obolibrary.org/obo/GO_0008219 denotes necrosis
T4 2060-2068 http://purl.obolibrary.org/obo/GO_0001906 denotes necrosis
T5 17333-17348 http://purl.obolibrary.org/obo/GO_0019068 denotes virion assembly
T6 17507-17520 http://purl.obolibrary.org/obo/GO_0006351 denotes transcription
T7 17748-17763 http://purl.obolibrary.org/obo/GO_0019068 denotes virion assembly
T8 17925-17934 http://purl.obolibrary.org/obo/GO_0009058 denotes formation
T9 17983-17996 http://purl.obolibrary.org/obo/GO_0006351 denotes transcription
T10 18001-18016 http://purl.obolibrary.org/obo/GO_0019068 denotes virion assembly
T11 18243-18257 http://purl.obolibrary.org/obo/GO_0019068 denotes viral assembly
T12 18284-18297 http://purl.obolibrary.org/obo/GO_0046755 denotes viral budding
T13 18290-18297 http://purl.obolibrary.org/obo/GO_0007114 denotes budding
T14 18327-18336 http://purl.obolibrary.org/obo/GO_0009058 denotes formation
T15 18719-18733 http://purl.obolibrary.org/obo/GO_0019068 denotes viral assembly
T16 18827-18857 http://purl.obolibrary.org/obo/GO_0019076 denotes virus’ exit from the host cell
T17 18834-18857 http://purl.obolibrary.org/obo/GO_0035891 denotes exit from the host cell
T18 18861-18874 http://purl.obolibrary.org/obo/GO_0046755 denotes viral budding
T19 18867-18874 http://purl.obolibrary.org/obo/GO_0007114 denotes budding
T20 18912-18921 http://purl.obolibrary.org/obo/GO_0009058 denotes formation

LitCovid-PD-HP

Id Subject Object Predicate Lexical cue hp_id
T1 1640-1649 Phenotype denotes pneumonia http://purl.obolibrary.org/obo/HP_0002090
T2 1807-1826 Phenotype denotes respiratory illness http://purl.obolibrary.org/obo/HP_0002086
T3 2054-2059 Phenotype denotes tumor http://purl.obolibrary.org/obo/HP_0002664
T4 4001-4010 Phenotype denotes pneumonia http://purl.obolibrary.org/obo/HP_0002090
T5 19359-19364 Phenotype denotes shock http://purl.obolibrary.org/obo/HP_0031273
T6 19554-19574 Phenotype denotes respiratory distress http://purl.obolibrary.org/obo/HP_0002098
T7 19614-19619 Phenotype denotes shock http://purl.obolibrary.org/obo/HP_0031273

LitCovid-sentences

Id Subject Object Predicate Lexical cue
T1 0-73 Sentence denotes State-of-the-art tools to identify druggable protein ligand of SARS-CoV-2
T2 75-83 Sentence denotes Abstract
T3 84-96 Sentence denotes Introduction
T4 97-314 Sentence denotes The SARS-CoV-2 (previously 2019-nCoV) outbreak in Wuhan, China and other parts of the world affects people and spreads coronavirus disease 2019 (COVID-19) through human-to-human contact, with a mortality rate of > 2%.
T5 315-388 Sentence denotes There are no approved drugs or vaccines yet available against SARS-CoV-2.
T6 390-410 Sentence denotes Material and methods
T7 411-554 Sentence denotes State-of-the-art tools based on in-silico methods are a cost-effective initial approach for identifying appropriate ligands against SARS-CoV-2.
T8 555-727 Sentence denotes The present study developed the 3D structure of the envelope and nucleocapsid phosphoprotein of SARS-CoV-2, and molecular docking analysis was done against various ligands.
T9 729-736 Sentence denotes Results
T10 737-1232 Sentence denotes The highest log octanol/water partition coefficient, high number of hydrogen bond donors and acceptors, lowest non-bonded interaction energy between the receptor and the ligand, and high binding affinity were considered for the best ligand for the envelope (mycophenolic acid: log P = 3.00; DG = –10.2567 kcal/mol; pKi = 7.713 µM) and nucleocapsid phosphoprotein (1-[(2,4-dichlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid: log P = 2.901; DG = –12.2112 kcal/mol; pKi = 7.885 µM) of SARS-CoV-2.
T11 1234-1245 Sentence denotes Conclusions
T12 1246-1419 Sentence denotes The study identifies the most potent compounds against the SARS-CoV-2 envelope and nucleocapsid phosphoprotein through state-of-the-art tools based on an in-silico approach.
T13 1420-1596 Sentence denotes A combination of these two ligands could be the best option to consider for further detailed studies to develop a drug for treating patients infected with SARS-CoV-2, COVID-19.
T14 1598-1610 Sentence denotes Introduction
T15 1611-1750 Sentence denotes In December 2019, an unknown pneumonia spread amongst a group of people in Wuhan, China, now termed as coronavirus disease 2019 (COVID-19).
T16 1751-2103 Sentence denotes COVID-19 patients were reported with a cluster of acute respiratory illness and higher interleukin 2 (IL-2), IL-7, IL-10, granulocyte colony-stimulating factor (GCSF), interferon gamma-induced protein 10 (IP10), monocyte chemoattractant protein 1 (MCP1), macrophage inflammatory protein 1a (MIP1A), and tumor necrosis factor a (TNF-a) in plasma [1, 2].
T17 2104-2349 Sentence denotes It was caused by an unknown beta coronavirus, initially called as 2019-nCoV; later the unknown beta coronavirus was named SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2), which formed a clade within the subgenus Sarbecovirus [2, 3].
T18 2350-2581 Sentence denotes Apart from the well-known MERS-CoV (Middle East respiratory syndrome coronavirus) and SARS-CoV (severe acute respiratory syndrome coronavirus), the SARS-CoV-2 is the seventh member of the coronavirus family that infects humans [4].
T19 2582-2709 Sentence denotes The genome of SARS-CoV-2 has 89% and 82% nucleotide similarity with bat SARS-like-CoVZXC21 and of human SARS-CoV, respectively.
T20 2710-2877 Sentence denotes The phylogenetic trees of spike, membrane, envelope, orf1a/b, and nucleoprotein from SARS-CoV-2 are clustered closely with those of the bat, civet, and human SARS-CoV.
T21 2878-3001 Sentence denotes The external subdomain of the spike’s receptor of SARS-CoV-2 has 40% amino acid similarity with other SARS-related CoV [5].
T22 3002-3063 Sentence denotes The entire orf3b of SARS-CoV-2 encodes a novel short protein.
T23 3064-3186 Sentence denotes Moreover, new orf8 of SARS-CoV-2 probably encodes a secreted protein with an a-helix, a b-sheet(s) having six strands [5].
T24 3187-3562 Sentence denotes The phylogenetic analysis of the complete viral genome (29,903 nucleotides) revealed that WH-Human-1 coronavirus (WHCV) or SARS-CoV-2 was most closely related (89.1% nucleotide similarity) to a group of SARS-like coronaviruses (genus Betacoronavirus, subgenus Sarbecovirus) that were previously sampled from bats in China and that have a history of genomic recombination [6].
T25 3563-3667 Sentence denotes A recent study confirmed that the SARS-CoV-2 uses the ACE2 cell entry receptor, similar to SARS-CoV [7].
T26 3668-3871 Sentence denotes Considering the outbreak and the high need for treatment strategies, we have carried out an in-silico approach to identify the best ligand against the SARS-CoV-2 envelope and nucleocapsid phosphoprotein.
T27 3873-3893 Sentence denotes Material and methods
T28 3895-3948 Sentence denotes Sequence retrieval and secondary structure prediction
T29 3949-4171 Sentence denotes The amino acid sequence of the Wuhan seafood market pneumonia virus envelope protein (Accession no QHD43418.1), nucleocapsid phosphoprotein (Accession no QHD43423.2), were retrieved from the NCBI database on 28th Jan 2020.
T30 4172-4519 Sentence denotes Wuhan seafood, SARS (severe acute respiratory syndrome), MERS (Middle East respiratory syndrome), and porcine reproductive and respiratory syndrome and other sequences were retrieved from NCBI, and sequence alignment was done by MAFFT software [8] for both envelop and nucleocapsid phosphoprotein, and phylogeny was constructed using MEGA7 [9–11].
T31 4521-4539 Sentence denotes Homology modelling
T32 4540-4668 Sentence denotes The sequences of envelope protein and nucleocapsid phosphoprotein were searched against the protein database using BLAST-P [12].
T33 4669-4696 Sentence denotes The proteins having PDB Id:
T34 4697-4959 Sentence denotes 1ssk.1.A for nucleocapsid phosphoprotein [13] and 5x29.1.A for envelope protein [https://swissmodel.expasy.org/repository/uniprot/A3EX99] were selected for use as a template for 3D modelling of the envelope protein and nucleocapsid phosphoproteins of SARS-CoV-2.
T35 4960-5024 Sentence denotes FASTA sequences were obtained for target and template selection.
T36 5026-5064 Sentence denotes 3D structure prediction and validation
T37 5065-5165 Sentence denotes Homology modelling structure prediction was carried out using the Automated SWISS MODEL server [14].
T38 5166-5249 Sentence denotes The modelled PDB file was visualised using PyMOL and validated using PROCHECK [15].
T39 5250-5392 Sentence denotes 3D models were validated on the basis of Ramachandran plot [16] statistics using the RAMPAGE server as described earlier [17] and ERRAT2 [18].
T40 5393-5676 Sentence denotes From the generated models, the one with highest number of residues in the allowed region and minimum number of residues in the disallowed region were considered as a suitable model for envelope protein and nucleocapsid phosphoprotein of SARS-CoV-2 and then used for further analysis.
T41 5677-5777 Sentence denotes The active site was predicted using the MOE (Molecular Operating Environment) tool site finder [19].
T42 5778-5928 Sentence denotes The two predicted models of 3D atomic coordinates of the receptor were used for computations to verify potential sites for ligand binding and docking.
T43 5930-5972 Sentence denotes Preparation of ligand for docking analysis
T44 5973-6083 Sentence denotes Chemical compounds were taken from the National Centre for Biotechnology Information (NCBI) Pub-Chem database.
T45 6084-6224 Sentence denotes All the ligands involved in our report were accumulated from the ones available in the literature [20–23], and others are listed in Table I.
T46 6225-6598 Sentence denotes The ligands for envelop protein (1I75, 2CBU, 2AAC, 1JR1) and nucleocapsid phosphoprotein (4UCE, 4UCC, 4UCD, 4UC8) were downloaded from a protein databank in Structure Data File (SDF) format and later converted to Protein Data Bank (PDB) coordinate files using Marvin space software, and ligands were saved in .mol format with the aim of opening these files in MOE software.
T47 6599-6725 Sentence denotes Energy minimisation was done using MOE tools to first protonate the structure by using default parameters pH 7 and temp 300˚C.
T48 6726-6794 Sentence denotes The selected ligand molecules were passed through a Lipinski filter.
T49 6795-6936 Sentence denotes Table I The properties of the ligands in the active site of envelope protein and nucleocapsid phosphoprotein of Wuhan coronavirus, 2019-nCoV
T50 6937-7011 Sentence denotes Protein Ligand Number of bonds HbA HbD Log P DG [kcal/mol] pKi [µM]
T51 7012-7057 Sentence denotes Envelope E1 5 5 4 –2.194 –7.1939 5.509
T52 7058-7093 Sentence denotes E2 5 5 2 3.00* –10.2567 7.713
T53 7094-7129 Sentence denotes E3 6 4 5 –3.899 –7.9052 8.105
T54 7130-7164 Sentence denotes E4 6 4 5 –3993 –6.7359 8.761
T55 7165-7229 Sentence denotes Nucleocapsid phosphoprotein N1 4 5 2 1.733 –10.3805 7.067
T56 7230-7266 Sentence denotes N2 2 5 2 2.901* –12.2112 7.885
T57 7267-7301 Sentence denotes N3 3 5 2 2.248 –9.3889 7.284
T58 7302-7337 Sentence denotes N4 1 2 1 –1.411 –8.6312 5.725
T59 7338-7622 Sentence denotes * Significant druggable protein ligand; HbA – hydrogen bond acceptors, HbD – hydrogen bond donors, log P – The log octanol/water partition coefficient, pKi – estimated binding affinity, E1 – b-D fucose, E2 – mycophenolic acid, E3 – castanospermine, E4 – deoxynojirimycinIs, N1 – M72:
T60 7623-7690 Sentence denotes 1-[(4-fluorophenyl)methyl]pyrazole-3,5-dicarboxylic acid, N2 – M76:
T61 7691-7762 Sentence denotes 1-[(2,4-dichlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid, N3 – M81:
T62 7763-7844 Sentence denotes 1-[(2-chlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid, N4 – P1: phenylalanine.
T63 7846-7863 Sentence denotes Molecular docking
T64 7864-8344 Sentence denotes For molecular docking the two modelled structures of selected antiviral molecules with envelope protein and nucleocapsid phosphoprotein were 3D protonated, and then docking was performed; we selected ligand (b-D-fucose; mycophenolic acid; castanospermine; deoxynojirimycin; 1-[(4-fluorophenyl)methyl]pyrazole-3,5-dicarboxylic acid; 1-[(2,4-dichlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid; 1-[(2 chlorophenyl) methyl]pyrazole-3,5-dicarboxylic acid, and the PHENYLALANINE atom.
T65 8345-8501 Sentence denotes Settings were selected in MOE software as rescoring1 at London dG and rescoring2 at GBVI/WSA dG, and the ligand interaction was performed with protein [24].
T66 8502-8614 Sentence denotes Four ligands were used for envelope protein, and another four ligands were used for nucleocapsid phosphoprotein.
T67 8615-8674 Sentence denotes Energy minimisation was done for both ligands and proteins.
T68 8675-8721 Sentence denotes Envelope protein before energy minimisation E:
T69 8722-8735 Sentence denotes 5471.98, RMS:
T70 8736-8775 Sentence denotes 14.93, and after energy minimisation E:
T71 8776-8789 Sentence denotes 2433.49, RMS:
T72 8790-8807 Sentence denotes G = 0.0709512, E:
T73 8808-8838 Sentence denotes 2489.62, RMS G = 0.0700238, E:
T74 8839-8852 Sentence denotes 2477.92, RMS:
T75 8853-8874 Sentence denotes G = 0.0713067, and E:
T76 8875-8888 Sentence denotes 2562.35, RMS:
T77 8889-9000 Sentence denotes G = 0.124056 with b-D-fucose, mycophenolic acid, castanospermine, and deoxynojirimycinIs ligands, respectively.
T78 9001-9063 Sentence denotes For nucleocapsid phosphoprotein before energy minimisation: E:
T79 9064-9076 Sentence denotes 2673.4, RMS:
T80 9077-9182 Sentence denotes G = 17.3825, and after energy minimisation E:475.537, RMS G = 0.0875944, E:428.511, RMS G = 0.0805305, E:
T81 9183-9217 Sentence denotes 372.844, RMS G = 0.0508421, and E:
T82 9218-9293 Sentence denotes 390.26, RMS G = 0.0939766 with M72, M76, M81, and P1 ligands, respectively.
T83 9295-9302 Sentence denotes Results
T84 9303-9483 Sentence denotes The amino acid sequences of envelope protein and nucleocapsid phosphoprotein were blasted against the PDB-BLAST database to identify an appropriate template for homology modelling.
T85 9484-9510 Sentence denotes The protein having PDB Id:
T86 9511-9722 Sentence denotes 1ssk.1.A (seq. identity 92.37, seq. similarity 0.61) and 5x29.1.A (seq. identity 91.38, seq. similarity 0.54) were selected as a template for 3D modelling of the envelope protein and nucleocapsid phosphoprotein.
T87 9723-9839 Sentence denotes The SWISS MODEL server was used to predict the 3D structure of the envelope protein and nucleocapsid phosphoprotein.
T88 9840-9933 Sentence denotes Models were built based on target-template alignment using ProMod3 in the SWISS MODEL server.
T89 9934-10126 Sentence denotes The best models of envelope protein and nucleocapsid phosphoprotein were selected based on the best QMEAN score (0.01) and highest resolution 2.48Å, and were validated using the RAMPAGE sever.
T90 10127-10228 Sentence denotes The protein structure’s stereochemical stability was calculated with the help of a Ramachandran plot.
T91 10229-10497 Sentence denotes The Ramachandran plot explained the 3D structure of the envelope protein and nucleocapsid phosphoprotein, showing 84% and 90.4% amino acid residue of predicted structure are in the favoured region for the nucleocapsid phosphoprotein and envelope protein, respectively.
T92 10498-10766 Sentence denotes Also, amino acid residues in the allowed region were 6.1% (nucleocapsid phosphoprotein) and 13.3% (envelope protein), and the remaining number of residues in the outlier region was 3.6% (nucleocapsid phosphoprotein; Figure 1 B) and 2.2% (envelope protein; Figure 1 B).
T93 10767-10911 Sentence denotes The overall quality factors for nucleocapsid phosphoprotein and envelope protein of the predicted models at ERRAT2 were 94 and 87, respectively.
T94 10912-11001 Sentence denotes Figure 1 A, B – Ramachandran plot from RAMPAGE of Wuhan coronavirus, SARS-CoV-2 protein.
T95 11002-11023 Sentence denotes A – Envelope protein.
T96 11024-11056 Sentence denotes B – Nucleocapsid phosphoprotein.
T97 11057-11117 Sentence denotes The phi (φ) values of amino acid residues are on the x-axis.
T98 11118-11155 Sentence denotes The psi (ψ) values are on the y-axis.
T99 11156-11260 Sentence denotes C, D – 3D structure of envelope protein (C) and nucleocapsid phosphoprotein (D) after homology modelling
T100 11262-11279 Sentence denotes Molecular docking
T101 11280-11559 Sentence denotes Envelope protein and nucleocapsid phosphoprotein of SARS-CoV-2 were prepared for molecular docking and were analysed by MOE software initially by 3D protonation, energy minimisation, and prediction of active site for the eight ligands by keeping the parameters at their defaults.
T102 11560-11730 Sentence denotes Then the ligands (E1 to E4 and N1 to N4) were docked separately with the envelope protein and nucleocapsid phosphoprotein of SARS-CoV-2 (Figures 2, 3) using MOE software.
T103 11731-12202 Sentence denotes The results from molecular docking suggested that the E2: mycophenolic acid (log P = 3.00; DG = –10.2567 kcal/mol; pKi = 7.713 µM) was the most potent druggable protein ligand of the SARS-CoV-2 envelope protein (Figures 2 A, B), while N2, 1-[(2,4-dichlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid (Log P = 2.901; DG = –12.2112 kcal/mol; pKi = 7.885 µM) was the most potent druggable protein ligand of SARS-CoV-2 nucleocapsid phosphoprotein protein (Table I, Figure 2).
T104 12203-12324 Sentence denotes Figure 2 Significant druggable protein ligand complex of envelope protein and nucleocapsid phosphoprotein of SARS-CoV-2.
T105 12325-12431 Sentence denotes E2 ligand has five hydrogen bonds: one with Asn_64, two with lys_63, one with val_49, and one with ILE_46.
T106 12432-12558 Sentence denotes N2 has two hydrogen bonds: one with Thr 49, and the other with Tyr112, in addition to one arene-arene interaction with Tyr 109
T107 12559-12671 Sentence denotes Figure 3 2D and 3D protein-ligand interaction of envelope protein and nucleocapsid phosphoprotein of SARS-CoV-2
T108 12673-12683 Sentence denotes Discussion
T109 12684-12780 Sentence denotes Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is a global pandemic health threat.
T110 12781-12905 Sentence denotes SARS-CoV-2 was identified as a new strain of the Beta-CoVs genera, and is a member of the zoonotic origin coronavirus group.
T111 12906-13060 Sentence denotes It causes coronavirus disease-2019 (COVID-19), which is the greatest concern in all the countries involved in the outbreak for health and economy reasons.
T112 13061-13147 Sentence denotes SARS-CoV-2 is distinct from the severe acute respiratory syndrome virus [2, 3, 25–27].
T113 13148-13404 Sentence denotes However, the phylogenetic analysis of the envelope protein and nucleocapsid phosphoprotein revealed that these proteins are close to the nucleocapsid phosphoprotein of bat coronavirus and severe acute respiratory syndrome-related coronavirus (Figures 4–6).
T114 13405-13534 Sentence denotes Hence, the study was designed to predict potent ligands against druggable envelope and nucleocapsid phosphoprotein of SARS-CoV-2.
T115 13535-13675 Sentence denotes The 3D models of the envelope protein and nucleocapsid phosphoprotein of SARS-CoV-2 were predicted, validated, and used for docking studies.
T116 13676-13889 Sentence denotes The docking studies help in the prediction of the preferred orientation of a ligand with the binding site on a protein and are used for conformation of various chemical compounds at the target site of the protein.
T117 13890-14401 Sentence denotes The most potent identified compounds for envelope protein, mycophenolic acid and nucleocapsid phosphoprotein, 1-[(2,4-dichloro-phenyl)methyl]pyrazole-3,5-dicarboxylic acid) with highest log octanol/water partition coefficient (Log P), high number of hydrogen bond donors and acceptors, lowest non-bonded interaction energy (DG) between the receptor and the ligand, and high binding affinity (pKi), indicate that they are the most potent compounds against the SARS-CoV-2 envelope and nucleocapsid phosphoprotein.
T118 14402-14632 Sentence denotes Figure 4 Phylogenetic analysis of the nucleocapsid phosphoprotein of SARS-CoV-2 by Maximum Likelihood method. “The evolutionary history was inferred by using the Maximum Likelihood method based on the JTT matrix-based model [11].
T119 14633-14769 Sentence denotes The bootstrap consensus tree inferred from 500 replicates [10] is taken to represent the evolutionary history of the taxa analysed [10].
T120 14770-14870 Sentence denotes Branches corresponding to partitions reproduced in less than 50% bootstrap replicates are collapsed.
T121 14871-15121 Sentence denotes Initial tree(s) for the heuristic search were obtained automatically by applying neighbour-joining and BioNJ algorithms to a matrix of pairwise distances estimated using a JTT model, and then selecting the topology with superior log likelihood value.
T122 15122-15168 Sentence denotes The analysis involved 78 amino acid sequences.
T123 15169-15232 Sentence denotes All positions containing gaps and missing data were eliminated.
T124 15233-15289 Sentence denotes There were a total of 43 positions in the final dataset.
T125 15290-15840 Sentence denotes Evolutionary analyses were conducted in MEGA7 [9].” Nucleocapsid phosphoprotein sequence used for constructing the phylogenetic tree: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
T126 15841-16008 Sentence denotes Figure 5 Representative of the multiple protein sequence alignment of envelope protein (A) and nucleocapsid phosphoprotein (B) of Wuhan novel coronavirus, SARS-CoV-2.
T127 16009-16145 Sentence denotes Envelope protein and nucleocapsid phosphoprotein sequence used for the sequence alignment are available in Figures 4 and 6, respectively
T128 16146-16384 Sentence denotes Figure 6 Phylogenetic analysis of the envelope protein of Wuhan coronavirus, SARS-CoV-2 by Maximum Likelihood method. “The evolutionary history was inferred by using the Maximum Likelihood method based on the JTT matrix-based model [11].
T129 16385-16521 Sentence denotes The bootstrap consensus tree inferred from 500 replicates [10] is taken to represent the evolutionary history of the taxa analysed [10].
T130 16522-16622 Sentence denotes Branches corresponding to partitions reproduced in less than 50% bootstrap replicates are collapsed.
T131 16623-16873 Sentence denotes Initial tree(s) for the heuristic search were obtained automatically by applying neighbour-joining and BioNJ algorithms to a matrix of pairwise distances estimated using a JTT model, and then selecting the topology with superior log likelihood value.
T132 16874-16920 Sentence denotes The analysis involved 78 amino acid sequences.
T133 16921-16984 Sentence denotes All positions containing gaps and missing data were eliminated.
T134 16985-17041 Sentence denotes There were a total of 43 positions in the final dataset.
T135 17042-17423 Sentence denotes Evolutionary analyses were conducted in MEGA7 [9].” Envelope protein sequence used for constructing the phylogenetic tree: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV The coronavirus nucleocapsid phosphoprotein is a multifunctional structural protein; during virion assembly it interacts with the viral membrane and forms complexes with genomic RNA.
T136 17424-17579 Sentence denotes The coronavirus nucleocapsid phosphoprotein plays an important role in coronavirus transcription and assembly as well as the coronavirus lifecycle [28–34].
T137 17580-18017 Sentence denotes The most potent identified compound, 1-[(2,4-dichlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid], may inhibit any of its multifarious activities and functions during virion assembly; however, detailed studies are needed on the inhibitory effect of these compounds on the interaction of nucleocapsid phosphoprotein with the viral membrane, and formation of complexes with genomic RNA during SARS-CoV-2 transcription and virion assembly.
T138 18018-18103 Sentence denotes The coronavirus envelope protein plays a crucial role for the lifecycle of the virus.
T139 18104-18447 Sentence denotes The small integral membrane protein, the coronavirus envelope protein, is important for the development of the disease in the host through viral assembly, to exit the host cell by viral budding, viral propagation, envelope formation by taking portions of the host cell membranes, and the release of infectious virus from the host cell [33–35].
T140 18448-18734 Sentence denotes Hence, the SARS-CoV-2 envelope protein was considered for the docking study to identify the most potent compound; the study revealed that mycophenolic acid may an appropriate druggable protein ligand of SARS-CoV-2 to inhibit the development of a COVID-19 by blocking the viral assembly.
T141 18735-19052 Sentence denotes Complete wet lab analysis is needed to elucidate the impact of the mycophenolic acid on the virus’ exit from the host cell by viral budding, the effect on blocking the envelope formation by taking portions of the host cell membranes, as well as its controlling power on release of infectious virus from the host cell.
T142 19053-19159 Sentence denotes There is no defined curative treatment for COVID-19 or any approved vaccines against SARS-CoV-2 infection.
T143 19160-19486 Sentence denotes The WHO recommendation for the management of MERS-CoV is being in practice: initiation of oxygen therapy to keep the oxygen saturation above 90%, with conservative fluid management in the absence of shock, and an empiric antimicrobial regimen that includes antibiotics and a neuraminidase inhibitor for treatment of influenza.
T144 19487-19631 Sentence denotes All of those supportive treatments are for the prevention of acute respiratory distress syndrome and for the prevention septic shock [2, 3, 36].
T145 19632-19723 Sentence denotes Hence, drug development against SARS-CoV-2 is considered urgent in order to fight COVID-19.
T146 19724-19885 Sentence denotes The present in-silico approach identifies one potent ligand against the envelope protein and one potent ligand against nucleocapsid phosphoprotein of SARS-CoV-2.
T147 19886-20072 Sentence denotes A combination of these two ligands might be the best option to consider for further detailed studies in wet laboratories to develop a drug for treating patients infected with SARS-CoV-2.
T148 20074-20089 Sentence denotes Acknowledgments
T149 20090-20287 Sentence denotes The authors thank the Dean of the Institute for Research and Medical Consultations (IRMC), Imam Abdulrahman Bin Faisal University, Dammam, Saudi Arabia for her continuous support and encouragement.
T150 20288-20364 Sentence denotes The authors thank Dr. Balu Kamaraj for his valuable support, and Mr. Ranilo.
T151 20365-20367 Sentence denotes M.
T152 20368-20394 Sentence denotes Tumbaga, and Mr. Horace T.
T153 20395-20437 Sentence denotes Pacifico for their support and assistance.
T154 20439-20459 Sentence denotes Conflict of interest
T155 20460-20504 Sentence denotes The authors declare no conflict of interest.

2_test

Id Subject Object Predicate Lexical cue
32399095-31986264-3961748 2097-2098 31986264 denotes 1
32399095-31978945-3961749 2578-2579 31978945 denotes 4
32399095-31987001-3961750 2998-2999 31987001 denotes 5
32399095-31987001-3961751 3183-3184 31987001 denotes 5
32399095-23329690-3961752 4417-4418 23329690 denotes 8
32399095-27004904-3961753 4513-4514 27004904 denotes 9
32399095-28561359-3961753 4513-4514 28561359 denotes 9
32399095-9254694-3961754 4664-4666 9254694 denotes 12
32399095-15147189-3961755 4739-4741 15147189 denotes 13
32399095-9504803-3961756 5161-5163 9504803 denotes 14
32399095-13990617-3961757 5310-5312 13990617 denotes 16
32399095-30768627-3961758 5372-5374 30768627 denotes 17
32399095-8401235-3961759 5388-5390 8401235 denotes 18
32399095-26246564-3961760 5773-5775 26246564 denotes 19
32399095-22623798-3961761 6183-6185 22623798 denotes 20
32399095-17170452-3961761 6183-6185 17170452 denotes 20
32399095-31953166-3961762 13140-13142 31953166 denotes 25
32399095-31986257-3961762 13140-13142 31986257 denotes 25
32399095-16103198-3961762 13140-13142 16103198 denotes 25
32399095-28561359-3961763 14692-14694 28561359 denotes 10
32399095-28561359-3961764 14765-14767 28561359 denotes 10
32399095-27004904-3961765 15337-15338 27004904 denotes 9
32399095-28561359-3961763 14692-14694 28561359 denotes 10
32399095-28561359-3961764 14765-14767 28561359 denotes 10
32399095-27004904-3961766 17089-17090 27004904 denotes 9
32399095-25105276-3961767 17572-17574 25105276 denotes 28
32399095-24418573-3961767 17572-17574 24418573 denotes 28
32399095-31776274-3961767 17572-17574 31776274 denotes 28
32399095-31756532-3961767 17572-17574 31756532 denotes 28
32399095-18184706-3961767 17572-17574 18184706 denotes 28
32399095-29287230-3961767 17572-17574 29287230 denotes 28
32399095-31133031-3961767 17572-17574 31133031 denotes 28
32399095-29287230-3961768 18440-18442 29287230 denotes 33
32399095-31133031-3961768 18440-18442 31133031 denotes 33
32399095-30867314-3961768 18440-18442 30867314 denotes 33

LitCovid-PubTator

Id Subject Object Predicate Lexical cue tao:has_database_id
9 101-111 Species denotes SARS-CoV-2 Tax:2697049
10 124-133 Species denotes 2019-nCoV Tax:2697049
11 197-203 Species denotes people Tax:9606
12 260-265 Species denotes human Tax:9606
13 269-274 Species denotes human Tax:9606
14 377-387 Species denotes SARS-CoV-2 Tax:2697049
15 216-240 Disease denotes coronavirus disease 2019 MESH:C000657245
16 242-250 Disease denotes COVID-19 MESH:C000657245
17 291-300 Disease denotes mortality MESH:D003643
22 620-632 Gene denotes nucleocapsid Gene:43740575
23 543-553 Species denotes SARS-CoV-2 Tax:2697049
24 651-661 Species denotes SARS-CoV-2 Tax:2697049
25 607-615 Gene denotes envelope Gene:43740570
30 1072-1084 Gene denotes nucleocapsid Gene:43740575
31 985-993 Gene denotes envelope Gene:43740570
32 1221-1231 Species denotes SARS-CoV-2 Tax:2697049
33 761-766 Chemical denotes water MESH:D014867
41 1329-1341 Gene denotes nucleocapsid Gene:43740575
42 1316-1324 Gene denotes envelope Gene:43740570
43 1305-1315 Species denotes SARS-CoV-2 Tax:2697049
44 1552-1560 Species denotes patients Tax:9606
45 1575-1585 Species denotes SARS-CoV-2 Tax:2697049
46 1561-1569 Disease denotes infected MESH:D007239
47 1587-1595 Disease denotes COVID-19 MESH:C000657245
104 1838-1851 Gene denotes interleukin 2 Gene:3558
105 1853-1857 Gene denotes IL-2 Gene:3558
106 1860-1864 Gene denotes IL-7 Gene:3574
107 1866-1871 Gene denotes IL-10 Gene:3586
108 1873-1910 Gene denotes granulocyte colony-stimulating factor Gene:1440
109 1912-1916 Gene denotes GCSF Gene:1440
110 1956-1960 Gene denotes IP10 Gene:3627
111 1963-1997 Gene denotes monocyte chemoattractant protein 1 Gene:6347
112 1999-2003 Gene denotes MCP1 Gene:6347
113 2006-2040 Gene denotes macrophage inflammatory protein 1a Gene:6348
114 2042-2047 Gene denotes MIP1A Gene:6348
115 2054-2077 Gene denotes tumor necrosis factor a Gene:7124
116 2079-2084 Gene denotes TNF-a Gene:7124
117 2763-2770 Gene denotes orf1a/b Gene:43740578
118 3013-3018 Gene denotes orf3b Gene:43740578
119 3617-3621 Gene denotes ACE2 Gene:59272
120 3078-3082 Gene denotes orf8 Gene:43740577
121 2736-2741 Gene denotes spike Gene:43740568
122 2753-2761 Gene denotes envelope Gene:43740570
123 1676-1682 Species denotes people Tax:9606
124 1760-1768 Species denotes patients Tax:9606
125 2132-2148 Species denotes beta coronavirus Tax:694002
126 2170-2179 Species denotes 2019-nCoV Tax:2697049
127 2199-2215 Species denotes beta coronavirus Tax:694002
128 2226-2236 Species denotes SARS-CoV-2 Tax:2697049
129 2238-2285 Species denotes severe acute respiratory syndrome coronavirus 2 Tax:2697049
130 2376-2384 Species denotes MERS-CoV Tax:1335626
131 2386-2430 Species denotes Middle East respiratory syndrome coronavirus Tax:1335626
132 2436-2444 Species denotes SARS-CoV Tax:694009
133 2446-2491 Species denotes severe acute respiratory syndrome coronavirus Tax:694009
134 2498-2508 Species denotes SARS-CoV-2 Tax:2697049
135 2538-2549 Species denotes coronavirus Tax:11118
136 2570-2576 Species denotes humans Tax:9606
137 2596-2606 Species denotes SARS-CoV-2 Tax:2697049
138 2680-2685 Species denotes human Tax:9606
139 2686-2694 Species denotes SARS-CoV Tax:694009
140 2795-2805 Species denotes SARS-CoV-2 Tax:2697049
141 2862-2867 Species denotes human Tax:9606
142 2868-2876 Species denotes SARS-CoV Tax:694009
143 2928-2938 Species denotes SARS-CoV-2 Tax:2697049
144 2980-2996 Species denotes SARS-related CoV Tax:694009
145 3022-3032 Species denotes SARS-CoV-2 Tax:2697049
146 3086-3096 Species denotes SARS-CoV-2 Tax:2697049
147 3277-3299 Species denotes WH-Human-1 coronavirus Tax:2697049
148 3310-3320 Species denotes SARS-CoV-2 Tax:2697049
149 3400-3413 Species denotes coronaviruses Tax:11118
150 3421-3436 Species denotes Betacoronavirus Tax:694002
151 3597-3607 Species denotes SARS-CoV-2 Tax:2697049
152 3654-3662 Species denotes SARS-CoV Tax:694009
153 3301-3305 Species denotes WHCV Tax:2697049
154 2908-2913 Gene denotes spike Gene:43740568
155 1640-1649 Disease denotes pneumonia MESH:D011014
156 1714-1738 Disease denotes coronavirus disease 2019 MESH:C000657245
157 1740-1748 Disease denotes COVID-19 MESH:C000657245
158 1751-1759 Disease denotes COVID-19 MESH:C000657245
159 1807-1826 Disease denotes respiratory illness MESH:D012140
163 3843-3855 Gene denotes nucleocapsid Gene:43740575
164 3830-3838 Gene denotes envelope Gene:43740570
165 3819-3829 Species denotes SARS-CoV-2 Tax:2697049
174 4061-4073 Gene denotes nucleocapsid Gene:43740575
175 4441-4453 Gene denotes nucleocapsid Gene:43740575
176 3980-4016 Species denotes Wuhan seafood market pneumonia virus Tax:2697049
177 4324-4339 Species denotes other sequences Tax:28384
178 4206-4217 Species denotes respiratory Tax:12814
179 4247-4258 Species denotes respiratory Tax:12814
180 4299-4310 Species denotes respiratory Tax:12814
181 4017-4033 Gene denotes envelope protein Gene:64006
190 4916-4928 Gene denotes nucleocapsid Gene:43740575
191 4710-4722 Gene denotes nucleocapsid Gene:43740575
192 4578-4590 Gene denotes nucleocapsid Gene:43740575
193 4689-4703 Gene denotes PDB Id: 1ssk.1
194 4760-4768 Gene denotes envelope Gene:43740570
195 4948-4958 Species denotes SARS-CoV-2 Tax:2697049
196 4895-4911 Gene denotes envelope protein Gene:64006
197 4557-4573 Gene denotes envelope protein Gene:64006
201 5599-5611 Gene denotes nucleocapsid Gene:43740575
202 5630-5640 Species denotes SARS-CoV-2 Tax:2697049
203 5578-5594 Gene denotes envelope protein Gene:64006
205 6286-6298 Gene denotes nucleocapsid Gene:43740575
208 7165-7177 Gene denotes Nucleocapsid Gene:43740575
209 6971-6986 Disease denotes HbA HbD Log P MESH:C000656865
213 6877-6889 Gene denotes nucleocapsid Gene:43740575
214 6908-6925 Species denotes Wuhan coronavirus Tax:2697049
215 6856-6872 Gene denotes envelope protein Gene:64006
219 7410-7413 Gene denotes HbD Gene:100187828
220 7525-7590 Gene denotes E1 – b-D fucose, E2 – mycophenolic acid, E3 – castanospermine, E4 Gene:9354
221 7462-7467 Chemical denotes water MESH:D014867
228 8675-8691 Gene denotes Envelope protein Gene:64006
229 9005-9017 Gene denotes nucleocapsid Gene:43740575
230 8586-8598 Gene denotes nucleocapsid Gene:43740575
231 7972-7984 Gene denotes nucleocapsid Gene:43740575
232 8529-8537 Gene denotes envelope Gene:43740570
233 7951-7967 Gene denotes envelope protein Gene:64006
241 9503-9517 Gene denotes PDB Id: 1ssk.1
242 9974-9986 Gene denotes nucleocapsid Gene:43740575
243 9811-9823 Gene denotes nucleocapsid Gene:43740575
244 9694-9706 Gene denotes nucleocapsid Gene:43740575
245 9953-9961 Gene denotes envelope Gene:43740570
246 9790-9806 Gene denotes envelope protein Gene:64006
247 9673-9689 Gene denotes envelope protein Gene:64006
256 10799-10811 Gene denotes nucleocapsid Gene:43740575
257 10685-10697 Gene denotes nucleocapsid Gene:43740575
258 10557-10569 Gene denotes nucleocapsid Gene:43740575
259 10306-10318 Gene denotes nucleocapsid Gene:43740575
260 10831-10839 Gene denotes envelope Gene:43740570
261 10736-10744 Gene denotes envelope Gene:43740570
262 10597-10613 Gene denotes envelope protein Gene:64006
263 10285-10301 Gene denotes envelope protein Gene:64006
268 11179-11231 Gene denotes envelope protein (C) and nucleocapsid phosphoprotein
269 11028-11040 Gene denotes Nucleocapsid Gene:43740575
270 10963-10980 Species denotes Wuhan coronavirus Tax:2697049
271 10982-10992 Species denotes SARS-CoV-2 Tax:2697049
282 11654-11666 Gene denotes nucleocapsid Gene:43740575
283 11301-11313 Gene denotes nucleocapsid Gene:43740575
284 11280-11288 Gene denotes Envelope Gene:43740570
285 11332-11342 Species denotes SARS-CoV-2 Tax:2697049
286 11685-11695 Species denotes SARS-CoV-2 Tax:2697049
287 11914-11924 Species denotes SARS-CoV-2 Tax:2697049
288 12135-12145 Species denotes SARS-CoV-2 Tax:2697049
289 11925-11941 Gene denotes envelope protein Gene:64006
290 11633-11649 Gene denotes envelope protein Gene:64006
291 12146-12158 Gene denotes nucleocapsid Gene:43740575
302 12282-12294 Gene denotes nucleocapsid Gene:43740575
303 12313-12323 Species denotes SARS-CoV-2 Tax:2697049
304 12261-12277 Gene denotes envelope protein Gene:64006
305 12432-12434 Chemical denotes N2
306 12443-12451 Chemical denotes hydrogen MESH:D006859
307 12468-12471 Chemical denotes Thr MESH:D013912
308 12495-12501 Chemical denotes Tyr112
309 12522-12527 Chemical denotes arene
310 12528-12533 Chemical denotes arene
311 12551-12554 Chemical denotes Tyr MESH:D014443
315 12569-12578 Gene denotes 2D and 3D
316 12630-12642 Gene denotes nucleocapsid Gene:43740575
317 12609-12625 Gene denotes envelope protein Gene:64006
345 13577-13589 Gene denotes nucleocapsid Gene:43740575
346 14373-14385 Gene denotes nucleocapsid Gene:43740575
347 13971-13983 Gene denotes nucleocapsid Gene:43740575
348 13492-13504 Gene denotes nucleocapsid Gene:43740575
349 13285-13297 Gene denotes nucleocapsid Gene:43740575
350 13211-13223 Gene denotes nucleocapsid Gene:43740575
351 14360-14368 Gene denotes envelope Gene:43740570
352 13931-13939 Gene denotes envelope Gene:43740570
353 13479-13487 Gene denotes envelope Gene:43740570
354 12684-12731 Species denotes Severe acute respiratory syndrome coronavirus 2 Tax:2697049
355 12733-12743 Species denotes SARS-CoV-2 Tax:2697049
356 12781-12791 Species denotes SARS-CoV-2 Tax:2697049
357 12835-12839 Species denotes CoVs Tax:11118
358 12887-12898 Species denotes coronavirus Tax:11118
359 13061-13071 Species denotes SARS-CoV-2 Tax:2697049
360 13093-13132 Species denotes severe acute respiratory syndrome virus Tax:694009
361 13316-13331 Species denotes bat coronavirus Tax:1508220
362 13336-13389 Species denotes severe acute respiratory syndrome-related coronavirus Tax:694009
363 13523-13533 Species denotes SARS-CoV-2 Tax:2697049
364 13608-13618 Species denotes SARS-CoV-2 Tax:2697049
365 14349-14359 Species denotes SARS-CoV-2 Tax:2697049
366 13556-13572 Gene denotes envelope protein Gene:64006
367 13190-13206 Gene denotes envelope protein Gene:64006
368 14088-14093 Chemical denotes water MESH:D014867
369 12871-12879 Disease denotes zoonotic MESH:D015047
370 12916-12940 Disease denotes coronavirus disease-2019 MESH:C000657245
371 12942-12950 Disease denotes COVID-19 MESH:C000657245
375 14441-14453 Gene denotes nucleocapsid Gene:43740575
376 15342-15354 Gene denotes Nucleocapsid Gene:43740575
377 14472-14482 Species denotes SARS-CoV-2 Tax:2697049
384 16009-16025 Gene denotes Envelope protein Gene:64006
385 16030-16042 Gene denotes nucleocapsid Gene:43740575
386 15937-15949 Gene denotes nucleocapsid Gene:43740575
387 15978-15995 Species denotes novel coronavirus Tax:2697049
388 15997-16007 Species denotes SARS-CoV-2 Tax:2697049
389 15912-15928 Gene denotes envelope protein Gene:64006
395 17094-17102 Gene denotes Envelope Gene:43740570
396 16205-16222 Species denotes Wuhan coronavirus Tax:2697049
397 16224-16234 Species denotes SARS-CoV-2 Tax:2697049
398 16185-16201 Gene denotes envelope protein Gene:64006
399 17165-17240 Disease denotes MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
409 17868-17880 Gene denotes nucleocapsid Gene:43740575
410 17440-17452 Gene denotes nucleocapsid Gene:43740575
411 17245-17256 Species denotes coronavirus Tax:11118
412 17428-17439 Species denotes coronavirus Tax:11118
413 17495-17506 Species denotes coronavirus Tax:11118
414 17549-17560 Species denotes coronavirus Tax:11118
415 17972-17982 Species denotes SARS-CoV-2 Tax:2697049
416 17257-17269 Gene denotes nucleocapsid Gene:43740575
417 17617-17677 Chemical denotes 1-[(2,4-dichlorophenyl)methyl]pyrazole-3,5-dicarboxylic acid
430 18034-18050 Gene denotes envelope protein Gene:64006
431 18157-18173 Gene denotes envelope protein Gene:64006
432 18903-18911 Gene denotes envelope Gene:43740570
433 18470-18478 Gene denotes envelope Gene:43740570
434 18318-18326 Gene denotes envelope Gene:43740570
435 18022-18033 Species denotes coronavirus Tax:11118
436 18145-18156 Species denotes coronavirus Tax:11118
437 18459-18469 Species denotes SARS-CoV-2 Tax:2697049
438 18651-18661 Species denotes SARS-CoV-2 Tax:2697049
439 18586-18603 Chemical denotes mycophenolic acid MESH:D009173
440 18802-18819 Chemical denotes mycophenolic acid MESH:D009173
441 18694-18702 Disease denotes COVID-19 MESH:C000657245
459 19435-19448 Gene denotes neuraminidase Gene:4758
460 19843-19855 Gene denotes nucleocapsid Gene:43740575
461 19205-19213 Species denotes MERS-CoV Tax:1335626
462 19664-19674 Species denotes SARS-CoV-2 Tax:2697049
463 19874-19884 Species denotes SARS-CoV-2 Tax:2697049
464 20038-20046 Species denotes patients Tax:9606
465 20061-20071 Species denotes SARS-CoV-2 Tax:2697049
466 19796-19812 Gene denotes envelope protein Gene:64006
467 19250-19256 Chemical denotes oxygen MESH:D010100
468 19277-19283 Chemical denotes oxygen MESH:D010100
469 19096-19104 Disease denotes COVID-19 MESH:C000657245
470 19138-19158 Disease denotes SARS-CoV-2 infection MESH:C000657245
471 19359-19364 Disease denotes shock MESH:D012769
472 19548-19583 Disease denotes acute respiratory distress syndrome MESH:D012128
473 19607-19619 Disease denotes septic shock MESH:D012772
474 19714-19722 Disease denotes COVID-19 MESH:C000657245
475 20047-20055 Disease denotes infected MESH:D007239